Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2629612..2630250 | Replicon | chromosome |
| Accession | NZ_CP109924 | ||
| Organism | Escherichia coli O125ac:K+:H10 strain C 236-04A | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | S1F9G9 |
| Locus tag | N8A72_RS12815 | Protein ID | WP_000813794.1 |
| Coordinates | 2630074..2630250 (-) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | N8A72_RS12810 | Protein ID | WP_001270286.1 |
| Coordinates | 2629612..2630028 (-) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N8A72_RS12790 (2624764) | 2624764..2625705 | - | 942 | WP_001251313.1 | ABC transporter permease | - |
| N8A72_RS12795 (2625706) | 2625706..2626719 | - | 1014 | WP_000220434.1 | ABC transporter ATP-binding protein | - |
| N8A72_RS12800 (2626737) | 2626737..2627882 | - | 1146 | WP_000047430.1 | ABC transporter substrate-binding protein | - |
| N8A72_RS12805 (2628127) | 2628127..2629533 | - | 1407 | WP_000760630.1 | PLP-dependent aminotransferase family protein | - |
| N8A72_RS12810 (2629612) | 2629612..2630028 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| N8A72_RS12815 (2630074) | 2630074..2630250 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| N8A72_RS12820 (2630472) | 2630472..2630702 | + | 231 | WP_000494244.1 | YncJ family protein | - |
| N8A72_RS12825 (2630794) | 2630794..2632755 | - | 1962 | WP_001488038.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| N8A72_RS12830 (2632828) | 2632828..2633364 | - | 537 | WP_000429169.1 | DNA-binding transcriptional regulator SutR | - |
| N8A72_RS12835 (2633456) | 2633456..2634631 | + | 1176 | WP_264454979.1 | BenE family transporter YdcO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T262385 WP_000813794.1 NZ_CP109924:c2630250-2630074 [Escherichia coli O125ac:K+:H10]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT262385 WP_001270286.1 NZ_CP109924:c2630028-2629612 [Escherichia coli O125ac:K+:H10]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|