Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 897783..898437 | Replicon | chromosome |
| Accession | NZ_CP109924 | ||
| Organism | Escherichia coli O125ac:K+:H10 strain C 236-04A | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | S1PAM6 |
| Locus tag | N8A72_RS04375 | Protein ID | WP_000244781.1 |
| Coordinates | 898030..898437 (+) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | N8A72_RS04370 | Protein ID | WP_000354046.1 |
| Coordinates | 897783..898049 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N8A72_RS04345 (892948) | 892948..893690 | + | 743 | Protein_856 | SDR family oxidoreductase | - |
| N8A72_RS04350 (893752) | 893752..895185 | - | 1434 | WP_001389468.1 | 6-phospho-beta-glucosidase BglA | - |
| N8A72_RS04355 (895230) | 895230..895541 | + | 312 | WP_001182957.1 | N(4)-acetylcytidine aminohydrolase | - |
| N8A72_RS04360 (895705) | 895705..896364 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
| N8A72_RS04365 (896560) | 896560..897540 | - | 981 | WP_000886082.1 | tRNA-modifying protein YgfZ | - |
| N8A72_RS04370 (897783) | 897783..898049 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| N8A72_RS04375 (898030) | 898030..898437 | + | 408 | WP_000244781.1 | protein YgfX | Toxin |
| N8A72_RS04380 (898477) | 898477..898998 | - | 522 | WP_001055868.1 | flavodoxin FldB | - |
| N8A72_RS04385 (899110) | 899110..900006 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
| N8A72_RS04390 (900031) | 900031..900741 | + | 711 | WP_000715213.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| N8A72_RS04395 (900747) | 900747..902480 | + | 1734 | WP_000813200.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T262375 WP_000244781.1 NZ_CP109924:898030-898437 [Escherichia coli O125ac:K+:H10]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|