Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/- |
| Location | 305403..306034 | Replicon | chromosome |
| Accession | NZ_CP109924 | ||
| Organism | Escherichia coli O125ac:K+:H10 strain C 236-04A | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | U9Y2A7 |
| Locus tag | N8A72_RS01365 | Protein ID | WP_001259385.1 |
| Coordinates | 305403..305678 (+) | Length | 92 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | U9Y7E1 |
| Locus tag | N8A72_RS01370 | Protein ID | WP_000593555.1 |
| Coordinates | 305675..306034 (+) | Length | 120 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N8A72_RS01350 (300407) | 300407..301474 | + | 1068 | WP_000361470.1 | HlyD family secretion protein | - |
| N8A72_RS01355 (301471) | 301471..304206 | + | 2736 | WP_000149123.1 | ribosome-associated ATPase/putative transporter RbbA | - |
| N8A72_RS01360 (304206) | 304206..305330 | + | 1125 | WP_001488398.1 | ABC transporter permease | - |
| N8A72_RS01365 (305403) | 305403..305678 | + | 276 | WP_001259385.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| N8A72_RS01370 (305675) | 305675..306034 | + | 360 | WP_000593555.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| N8A72_RS01375 (306154) | 306154..306555 | - | 402 | WP_001190062.1 | nickel-responsive transcriptional regulator NikR | - |
| N8A72_RS01380 (306561) | 306561..307367 | - | 807 | WP_000173666.1 | nickel import ATP-binding protein NikE | - |
| N8A72_RS01385 (307364) | 307364..308128 | - | 765 | WP_001136236.1 | nickel import ATP-binding protein NikD | - |
| N8A72_RS01390 (308128) | 308128..308961 | - | 834 | WP_001008963.1 | nickel ABC transporter permease subunit NikC | - |
| N8A72_RS01395 (308958) | 308958..309902 | - | 945 | WP_000947068.1 | nickel ABC transporter permease subunit NikB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 285110..306034 | 20924 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10199.94 Da Isoelectric Point: 10.7076
>T262371 WP_001259385.1 NZ_CP109924:305403-305678 [Escherichia coli O125ac:K+:H10]
MRTKVQALRKKQKNTLDQIFKTPVPQGIKWSDIESLVKALGGEIKEGRGSRCKFILNMSVACFHRPHPSPDTDKGAVESV
RDWLLSIGVKP
MRTKVQALRKKQKNTLDQIFKTPVPQGIKWSDIESLVKALGGEIKEGRGSRCKFILNMSVACFHRPHPSPDTDKGAVESV
RDWLLSIGVKP
Download Length: 276 bp
Antitoxin
Download Length: 120 a.a. Molecular weight: 13402.27 Da Isoelectric Point: 5.1987
>AT262371 WP_000593555.1 NZ_CP109924:305675-306034 [Escherichia coli O125ac:K+:H10]
MIKLKTPNSMEIAGQPAVITYVPELNAFRGKFLGLSGYCDFVSDSIQGLQKEGELSLREYLEDCKAAGIEPYARTEKIKT
FTLRYPESLSERLNNAAAQQQVSVNTYIIETLNERLNHL
MIKLKTPNSMEIAGQPAVITYVPELNAFRGKFLGLSGYCDFVSDSIQGLQKEGELSLREYLEDCKAAGIEPYARTEKIKT
FTLRYPESLSERLNNAAAQQQVSVNTYIIETLNERLNHL
Download Length: 360 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4P7TTW8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9LKZ6 |