Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4205646..4206482 | Replicon | chromosome |
| Accession | NZ_CP109921 | ||
| Organism | Escherichia coli O2:K2:H1 strain C 237-04 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | - |
| Locus tag | N7L43_RS20420 | Protein ID | WP_171854745.1 |
| Coordinates | 4205646..4206023 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | S1NQ68 |
| Locus tag | N7L43_RS20425 | Protein ID | WP_001540478.1 |
| Coordinates | 4206114..4206482 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N7L43_RS20400 (4202996) | 4202996..4204260 | - | 1265 | Protein_4003 | integrase arm-type DNA-binding domain-containing protein | - |
| N7L43_RS20405 (4204727) | 4204727..4204876 | - | 150 | Protein_4004 | restriction endonuclease subunit M | - |
| N7L43_RS20410 (4204961) | 4204961..4205149 | - | 189 | WP_171854743.1 | DUF957 domain-containing protein | - |
| N7L43_RS20415 (4205161) | 4205161..4205649 | - | 489 | WP_171854744.1 | DUF5983 family protein | - |
| N7L43_RS20420 (4205646) | 4205646..4206023 | - | 378 | WP_171854745.1 | TA system toxin CbtA family protein | Toxin |
| N7L43_RS20425 (4206114) | 4206114..4206482 | - | 369 | WP_001540478.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| N7L43_RS20430 (4206645) | 4206645..4206866 | - | 222 | WP_000692315.1 | DUF987 domain-containing protein | - |
| N7L43_RS20435 (4206935) | 4206935..4207411 | - | 477 | WP_231239548.1 | RadC family protein | - |
| N7L43_RS20440 (4207427) | 4207427..4207912 | - | 486 | WP_044860884.1 | antirestriction protein | - |
| N7L43_RS20445 (4207967) | 4207967..4208785 | - | 819 | WP_001234616.1 | DUF932 domain-containing protein | - |
| N7L43_RS20450 (4208885) | 4208885..4209118 | - | 234 | WP_001119729.1 | DUF905 family protein | - |
| N7L43_RS20455 (4209197) | 4209197..4209652 | - | 456 | WP_000581504.1 | IrmA family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14251.31 Da Isoelectric Point: 8.2905
>T262368 WP_171854745.1 NZ_CP109921:c4206023-4205646 [Escherichia coli O2:K2:H1]
MKTLPDTHVREASRCPFPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEAKR
MKTLPDTHVREASRCPFPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13652.53 Da Isoelectric Point: 7.8398
>AT262368 WP_001540478.1 NZ_CP109921:c4206482-4206114 [Escherichia coli O2:K2:H1]
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|