Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 4036315..4036865 Replicon chromosome
Accession NZ_CP109921
Organism Escherichia coli O2:K2:H1 strain C 237-04

Toxin (Protein)


Gene name ccdB Uniprot ID S1PDG4
Locus tag N7L43_RS19615 Protein ID WP_001160966.1
Coordinates 4036315..4036629 (-) Length 105 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V0VEX8
Locus tag N7L43_RS19620 Protein ID WP_000125566.1
Coordinates 4036632..4036865 (-) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N7L43_RS19590 (4031990) 4031990..4033276 + 1287 WP_000800457.1 peptidylprolyl isomerase SurA -
N7L43_RS19595 (4033276) 4033276..4034265 + 990 WP_000241229.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
N7L43_RS19600 (4034262) 4034262..4035083 + 822 WP_001065363.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
N7L43_RS19605 (4035086) 4035086..4035463 + 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
N7L43_RS19610 (4035470) 4035470..4036318 + 849 WP_000257182.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
N7L43_RS19615 (4036315) 4036315..4036629 - 315 WP_001160966.1 CcdB family protein Toxin
N7L43_RS19620 (4036632) 4036632..4036865 - 234 WP_000125566.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
N7L43_RS19625 (4036951) 4036951..4037430 - 480 WP_000624375.1 type 3 dihydrofolate reductase -
N7L43_RS19630 (4037622) 4037622..4039484 - 1863 WP_000377123.1 glutathione-regulated potassium-efflux system protein KefC -
N7L43_RS19635 (4039477) 4039477..4040007 - 531 WP_000600725.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
N7L43_RS19640 (4040115) 4040115..4041446 - 1332 WP_001183207.1 MFS transporter -
N7L43_RS19645 (4041505) 4041505..4041792 - 288 WP_000203741.1 ferredoxin-like protein FixX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-103)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11711.72 Da        Isoelectric Point: 9.0851

>T262362 WP_001160966.1 NZ_CP109921:c4036629-4036315 [Escherichia coli O2:K2:H1]
MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSRIRPPERLNPILLLVDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIKGALDFMLDGI

Download         Length: 315 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8530.53 Da        Isoelectric Point: 5.8062

>AT262362 WP_000125566.1 NZ_CP109921:c4036865-4036632 [Escherichia coli O2:K2:H1]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENAEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829G815

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LTM9

References