Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 3837195..3837993 | Replicon | chromosome |
| Accession | NZ_CP109921 | ||
| Organism | Escherichia coli O2:K2:H1 strain C 237-04 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | Q8VRA6 |
| Locus tag | N7L43_RS18675 | Protein ID | WP_000854730.1 |
| Coordinates | 3837616..3837993 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A0P0SQV8 |
| Locus tag | N7L43_RS18670 | Protein ID | WP_001285481.1 |
| Coordinates | 3837195..3837569 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N7L43_RS18630 (3833170) | 3833170..3833622 | + | 453 | WP_000682723.1 | hypothetical protein | - |
| N7L43_RS18635 (3833740) | 3833740..3833973 | + | 234 | WP_001213776.1 | DUF905 family protein | - |
| N7L43_RS18640 (3834073) | 3834073..3834894 | + | 822 | WP_001234359.1 | DUF932 domain-containing protein | - |
| N7L43_RS18645 (3834894) | 3834894..3835139 | + | 246 | WP_001164966.1 | hypothetical protein | - |
| N7L43_RS18650 (3835233) | 3835233..3835706 | + | 474 | WP_001313575.1 | antirestriction protein | - |
| N7L43_RS18655 (3835722) | 3835722..3836198 | + | 477 | WP_001313574.1 | RadC family protein | - |
| N7L43_RS18660 (3836261) | 3836261..3836482 | + | 222 | WP_000692315.1 | DUF987 domain-containing protein | - |
| N7L43_RS18665 (3836501) | 3836501..3837145 | + | 645 | WP_000086759.1 | hypothetical protein | - |
| N7L43_RS18670 (3837195) | 3837195..3837569 | + | 375 | WP_001285481.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| N7L43_RS18675 (3837616) | 3837616..3837993 | + | 378 | WP_000854730.1 | TA system toxin CbtA family protein | Toxin |
| N7L43_RS18680 (3837990) | 3837990..3838482 | + | 493 | Protein_3668 | DUF5983 family protein | - |
| N7L43_RS18685 (3838561) | 3838561..3839549 | - | 989 | Protein_3669 | IS630 family transposase | - |
| N7L43_RS18690 (3839697) | 3839697..3839885 | - | 189 | Protein_3670 | IS66 family transposase | - |
| N7L43_RS18695 (3839946) | 3839946..3841079 | + | 1134 | WP_000555410.1 | IS110-like element ISEc45 family transposase | - |
| N7L43_RS18700 (3841333) | 3841333..3842737 | - | 1405 | Protein_3672 | IS66 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14212.21 Da Isoelectric Point: 7.2923
>T262361 WP_000854730.1 NZ_CP109921:3837616-3837993 [Escherichia coli O2:K2:H1]
MKTLPDTHVREASRCPSPVTIWQTLLTQLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRSNYRMVNDIIRGEHSEAKR
MKTLPDTHVREASRCPSPVTIWQTLLTQLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRSNYRMVNDIIRGEHSEAKR
Download Length: 378 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 13817.53 Da Isoelectric Point: 4.7511
>AT262361 WP_001285481.1 NZ_CP109921:3837195-3837569 [Escherichia coli O2:K2:H1]
VSDTLHETNYPDDNNDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGQFSDADAYHLDQAFPLLMKQLELMLTIG
ELNPRHQHTVTLYARGLTCEADTLGSCGYVYMAVYPTLAPATTS
VSDTLHETNYPDDNNDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGQFSDADAYHLDQAFPLLMKQLELMLTIG
ELNPRHQHTVTLYARGLTCEADTLGSCGYVYMAVYPTLAPATTS
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H2V671 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0P0SQV8 |