Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3542484..3543102 | Replicon | chromosome |
Accession | NZ_CP109921 | ||
Organism | Escherichia coli O2:K2:H1 strain C 237-04 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | N7L43_RS17325 | Protein ID | WP_001291435.1 |
Coordinates | 3542884..3543102 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | N7L43_RS17320 | Protein ID | WP_000344800.1 |
Coordinates | 3542484..3542858 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N7L43_RS17310 (3537574) | 3537574..3538767 | + | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
N7L43_RS17315 (3538790) | 3538790..3541939 | + | 3150 | WP_171854650.1 | efflux RND transporter permease AcrB | - |
N7L43_RS17320 (3542484) | 3542484..3542858 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
N7L43_RS17325 (3542884) | 3542884..3543102 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
N7L43_RS17330 (3543275) | 3543275..3543826 | + | 552 | WP_000102539.1 | maltose O-acetyltransferase | - |
N7L43_RS17335 (3543942) | 3543942..3544412 | + | 471 | WP_001304825.1 | YlaC family protein | - |
N7L43_RS17340 (3544576) | 3544576..3546126 | + | 1551 | WP_001528761.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
N7L43_RS17345 (3546168) | 3546168..3546521 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
N7L43_RS17355 (3546900) | 3546900..3547211 | + | 312 | WP_000409908.1 | MGMT family protein | - |
N7L43_RS17360 (3547242) | 3547242..3547814 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T262360 WP_001291435.1 NZ_CP109921:3542884-3543102 [Escherichia coli O2:K2:H1]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT262360 WP_000344800.1 NZ_CP109921:3542484-3542858 [Escherichia coli O2:K2:H1]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |