Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 1044799..1045453 | Replicon | chromosome |
Accession | NZ_CP109921 | ||
Organism | Escherichia coli O2:K2:H1 strain C 237-04 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | S1PAM6 |
Locus tag | N7L43_RS05180 | Protein ID | WP_000244781.1 |
Coordinates | 1045046..1045453 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | N7L43_RS05175 | Protein ID | WP_000354046.1 |
Coordinates | 1044799..1045065 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N7L43_RS05155 (1040887) | 1040887..1042320 | - | 1434 | WP_021519470.1 | 6-phospho-beta-glucosidase BglA | - |
N7L43_RS05160 (1042365) | 1042365..1042676 | + | 312 | WP_001182956.1 | N(4)-acetylcytidine aminohydrolase | - |
N7L43_RS05165 (1042840) | 1042840..1043499 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
N7L43_RS05170 (1043576) | 1043576..1044556 | - | 981 | WP_000886079.1 | tRNA-modifying protein YgfZ | - |
N7L43_RS05175 (1044799) | 1044799..1045065 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
N7L43_RS05180 (1045046) | 1045046..1045453 | + | 408 | WP_000244781.1 | protein YgfX | Toxin |
N7L43_RS05185 (1045493) | 1045493..1046014 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
N7L43_RS05190 (1046126) | 1046126..1047022 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
N7L43_RS05195 (1047047) | 1047047..1047757 | + | 711 | WP_000715230.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
N7L43_RS05200 (1047763) | 1047763..1049496 | + | 1734 | WP_000813189.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T262353 WP_000244781.1 NZ_CP109921:1045046-1045453 [Escherichia coli O2:K2:H1]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|