Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 821438..822272 Replicon chromosome
Accession NZ_CP109921
Organism Escherichia coli O2:K2:H1 strain C 237-04

Toxin (Protein)


Gene name yeeV Uniprot ID A0A0H2VDB0
Locus tag N7L43_RS04010 Protein ID WP_000854688.1
Coordinates 821438..821815 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A0H2VAY1
Locus tag N7L43_RS04015 Protein ID WP_001285596.1
Coordinates 821892..822272 (-) Length 127 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N7L43_RS03980 (817831) 817831..818001 - 171 Protein_782 IS110 family transposase -
N7L43_RS03985 (818418) 818418..819352 - 935 Protein_783 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
N7L43_RS03990 (819345) 819345..819740 - 396 WP_000208383.1 DUF6088 family protein -
N7L43_RS03995 (819809) 819809..820654 - 846 WP_001280441.1 DUF4942 domain-containing protein -
N7L43_RS04000 (820739) 820739..820936 - 198 WP_000839260.1 DUF957 domain-containing protein -
N7L43_RS04005 (820953) 820953..821441 - 489 WP_000761701.1 DUF5983 family protein -
N7L43_RS04010 (821438) 821438..821815 - 378 WP_000854688.1 TA system toxin CbtA family protein Toxin
N7L43_RS04015 (821892) 821892..822272 - 381 WP_001285596.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
N7L43_RS04020 (822322) 822322..822966 - 645 WP_000094917.1 hypothetical protein -
N7L43_RS04025 (822985) 822985..823206 - 222 WP_000692329.1 DUF987 domain-containing protein -
N7L43_RS04030 (823269) 823269..823745 - 477 WP_001186726.1 RadC family protein -
N7L43_RS04035 (823761) 823761..824246 - 486 WP_000849565.1 antirestriction protein -
N7L43_RS04040 (824301) 824301..825119 - 819 WP_001234616.1 DUF932 domain-containing protein -
N7L43_RS04045 (825220) 825220..825453 - 234 WP_001119727.1 DUF905 family protein -
N7L43_RS04050 (825532) 825532..825987 - 456 WP_000581502.1 IrmA family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - kpsM / kpsT / kpsS / kpsC / kpsU / kpsD / kpsE / kpsF 799820..824246 24426


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14014.01 Da        Isoelectric Point: 8.5221

>T262352 WP_000854688.1 NZ_CP109921:c821815-821438 [Escherichia coli O2:K2:H1]
MKTLPDTHVRAASRCPSPVTIWQTLLTQLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR

Download         Length: 378 bp

Antitoxin


Download         Length: 127 a.a.        Molecular weight: 13897.70 Da        Isoelectric Point: 4.7959

>AT262352 WP_001285596.1 NZ_CP109921:c822272-821892 [Escherichia coli O2:K2:H1]
MSDTLPGTTLPDDNKDLPWWGLPCAVTPCFGARLVQEGNRLHYLADRAGIRGRFSNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCDADTLGSCGYVYLAVYPATETESNPPE

Download         Length: 381 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H2VDB0

Antitoxin

Source ID Structure
AlphaFold DB A0A0H2VAY1

References