Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PP_4151-4152/excise(antitoxin) |
Location | 2734282..2735324 | Replicon | chromosome |
Accession | NZ_CP109920 | ||
Organism | Pseudomonas aeruginosa strain PALA39 |
Toxin (Protein)
Gene name | PP_4152 | Uniprot ID | - |
Locus tag | PALA39_RS13000 | Protein ID | WP_003109777.1 |
Coordinates | 2734749..2735324 (+) | Length | 192 a.a. |
Antitoxin (Protein)
Gene name | PP_4151 | Uniprot ID | I3TV68 |
Locus tag | PALA39_RS12995 | Protein ID | WP_003050245.1 |
Coordinates | 2734282..2734752 (+) | Length | 157 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PALA39_RS12960 (PALA39_02571) | 2729674..2731092 | - | 1419 | WP_003109776.1 | TIGR03752 family integrating conjugative element protein | - |
PALA39_RS12965 (PALA39_02572) | 2731082..2731993 | - | 912 | WP_003105643.1 | TIGR03749 family integrating conjugative element protein | - |
PALA39_RS12970 (PALA39_02573) | 2731990..2732682 | - | 693 | WP_003105641.1 | TIGR03746 family integrating conjugative element protein | - |
PALA39_RS12975 (PALA39_02574) | 2732679..2733077 | - | 399 | WP_003105639.1 | TIGR03750 family conjugal transfer protein | - |
PALA39_RS12980 (PALA39_02575) | 2733089..2733448 | - | 360 | WP_003090173.1 | TIGR03745 family integrating conjugative element membrane protein | - |
PALA39_RS12985 (PALA39_02576) | 2733465..2733698 | - | 234 | WP_003050225.1 | TIGR03758 family integrating conjugative element protein | - |
PALA39_RS12990 (PALA39_02577) | 2733695..2734078 | - | 384 | WP_003105635.1 | RAQPRD family integrative conjugative element protein | - |
PALA39_RS12995 (PALA39_02578) | 2734282..2734752 | + | 471 | WP_003050245.1 | helix-turn-helix domain-containing protein | Antitoxin |
PALA39_RS13000 (PALA39_02579) | 2734749..2735324 | + | 576 | WP_003109777.1 | PIN domain-containing protein | Toxin |
PALA39_RS13005 (PALA39_02580) | 2735342..2736256 | + | 915 | WP_003105629.1 | AAA family ATPase | - |
PALA39_RS13010 (PALA39_02581) | 2736253..2736723 | + | 471 | WP_003105626.1 | type III CBASS phage resistance system CD-NTase-associated protein Cap8 | - |
PALA39_RS13015 (PALA39_02582) | 2736720..2737220 | + | 501 | WP_003090159.1 | type III CBASS phage resistance system CD-NTase-associated protein Cap7 | - |
PALA39_RS13020 (PALA39_02583) | 2737220..2738122 | + | 903 | WP_003105624.1 | CBASS oligonucleotide cyclase | - |
PALA39_RS13025 (PALA39_02584) | 2738161..2738886 | + | 726 | WP_003050273.1 | CBASS effector endonuclease NucC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 2679303..2784131 | 104828 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 192 a.a. Molecular weight: 21644.79 Da Isoelectric Point: 5.6172
>T262345 WP_003109777.1 NZ_CP109920:2734749-2735324 [Pseudomonas aeruginosa]
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPDDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIEVDRYLEILLRQGLVQTTKVLATYRTIL
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPDDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIEVDRYLEILLRQGLVQTTKVLATYRTIL
Download Length: 576 bp
Antitoxin
Download Length: 157 a.a. Molecular weight: 17245.62 Da Isoelectric Point: 6.3803
>AT262345 WP_003050245.1 NZ_CP109920:2734282-2734752 [Pseudomonas aeruginosa]
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE
Download Length: 471 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|