Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relB-parE/RHH(antitoxin) |
| Location | 2488784..2489337 | Replicon | chromosome |
| Accession | NZ_CP109920 | ||
| Organism | Pseudomonas aeruginosa strain PALA39 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | Q88JZ3 |
| Locus tag | PALA39_RS11890 | Protein ID | WP_010953434.1 |
| Coordinates | 2489044..2489337 (+) | Length | 98 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | Q88JZ4 |
| Locus tag | PALA39_RS11885 | Protein ID | WP_010953433.1 |
| Coordinates | 2488784..2489056 (+) | Length | 91 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PALA39_RS11855 (PALA39_02356) | 2484356..2484715 | - | 360 | Protein_2340 | DNA repair protein RadC | - |
| PALA39_RS11860 (PALA39_02357) | 2484687..2485637 | - | 951 | WP_031299400.1 | hypothetical protein | - |
| PALA39_RS11865 (PALA39_02358) | 2485730..2486734 | - | 1005 | WP_010953429.1 | YqaJ viral recombinase family protein | - |
| PALA39_RS11870 (PALA39_02359) | 2486814..2487782 | - | 969 | WP_031299399.1 | DUF932 domain-containing protein | - |
| PALA39_RS11875 (PALA39_02360) | 2487880..2488209 | - | 330 | WP_010953431.1 | hypothetical protein | - |
| PALA39_RS11880 (PALA39_02361) | 2488414..2488659 | + | 246 | WP_010953432.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| PALA39_RS11885 (PALA39_02362) | 2488784..2489056 | + | 273 | WP_010953433.1 | CopG family ribbon-helix-helix protein | Antitoxin |
| PALA39_RS11890 | 2489044..2489337 | + | 294 | WP_010953434.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PALA39_RS11895 (PALA39_02363) | 2489331..2490740 | - | 1410 | WP_010953435.1 | site-specific integrase | - |
| PALA39_RS11900 (PALA39_02364) | 2491178..2493958 | + | 2781 | WP_023464835.1 | type I restriction-modification enzyme R subunit C-terminal domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 2460809..2511806 | 50997 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 11155.61 Da Isoelectric Point: 5.9081
>T262344 WP_010953434.1 NZ_CP109920:2489044-2489337 [Pseudomonas aeruginosa]
VPRLIVTEGAAKGLERCRRFLSDKDPQVARRAAQAIERQFARLEESPEVGRPFPDLPELRELIIEFGDSGYVALYRYERA
DDTAYVLAFRHQKEAGY
VPRLIVTEGAAKGLERCRRFLSDKDPQVARRAAQAIERQFARLEESPEVGRPFPDLPELRELIIEFGDSGYVALYRYERA
DDTAYVLAFRHQKEAGY
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2W5CNE8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | Q88JZ4 |