Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PfiT-PfiA/ParE(toxin) |
Location | 4913680..4914288 | Replicon | chromosome |
Accession | NZ_CP109918 | ||
Organism | Pseudomonas aeruginosa strain PALA55 |
Toxin (Protein)
Gene name | PfiT | Uniprot ID | A0A444LUU5 |
Locus tag | PALA55_RS22920 | Protein ID | WP_019486378.1 |
Coordinates | 4913680..4914027 (-) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | PfiA | Uniprot ID | A0A0B0C355 |
Locus tag | PALA55_RS22925 | Protein ID | WP_003114155.1 |
Coordinates | 4914037..4914288 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PALA55_RS22890 (PALA55_04528) | 4909041..4909313 | + | 273 | WP_003120794.1 | cysteine-rich CWC family protein | - |
PALA55_RS22895 (PALA55_04529) | 4909313..4910005 | + | 693 | WP_003098362.1 | 16S rRNA pseudouridine(516) synthase | - |
PALA55_RS22900 (PALA55_04530) | 4910141..4911184 | + | 1044 | WP_003098363.1 | L,D-transpeptidase | - |
PALA55_RS22905 (PALA55_04531) | 4911264..4912001 | + | 738 | WP_003085453.1 | murein L,D-transpeptidase catalytic domain family protein | - |
PALA55_RS22910 (PALA55_04532) | 4912453..4913355 | + | 903 | WP_003098365.1 | (R)-3-hydroxydecanoyl-ACP:CoA transacylase | - |
PALA55_RS22920 (PALA55_04534) | 4913680..4914027 | - | 348 | WP_019486378.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PALA55_RS22925 | 4914037..4914288 | - | 252 | WP_003114155.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
PALA55_RS22930 (PALA55_04535) | 4914502..4915485 | - | 984 | WP_019682343.1 | tyrosine-type recombinase/integrase | - |
PALA55_RS22935 (PALA55_04536) | 4915485..4916777 | - | 1293 | WP_023088869.1 | hypothetical protein | - |
PALA55_RS22940 (PALA55_04538) | 4917007..4918281 | - | 1275 | WP_109392597.1 | zonular occludens toxin family protein | - |
PALA55_RS22945 (PALA55_04539) | 4918285..4918641 | - | 357 | WP_003114150.1 | DUF2523 family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | catB7 | - | 4913680..4935824 | 22144 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 12956.72 Da Isoelectric Point: 4.4212
>T262334 WP_019486378.1 NZ_CP109918:c4914027-4913680 [Pseudomonas aeruginosa]
MSPVVIRFTDTAEQSIEDQVHHLAPFQGEQAALQSVLSLLDEIEEKISLAPKGYPVSQQASLLGVLSYRELNTGPYRVFY
EFHEEQGEAAVILVLRQKQSVEQQLIRYCLVGPIE
MSPVVIRFTDTAEQSIEDQVHHLAPFQGEQAALQSVLSLLDEIEEKISLAPKGYPVSQQASLLGVLSYRELNTGPYRVFY
EFHEEQGEAAVILVLRQKQSVEQQLIRYCLVGPIE
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A444LUU5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0B0C355 |