Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 794..1313 | Replicon | plasmid pASal1_J227 |
| Accession | NZ_CP109911 | ||
| Organism | Aeromonas salmonicida subsp. salmonicida strain J227 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | Q7X2F1 |
| Locus tag | AXW80_RS23320 | Protein ID | WP_005321942.1 |
| Coordinates | 1026..1313 (+) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | Q8GMP0 |
| Locus tag | AXW80_RS23315 | Protein ID | WP_011069626.1 |
| Coordinates | 794..1036 (+) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AXW80_RS23305 (AXW80_23235) | 107..313 | + | 207 | WP_129712442.1 | hypothetical protein | - |
| AXW80_RS23310 (AXW80_23240) | 430..762 | + | 333 | WP_005321955.1 | hypothetical protein | - |
| AXW80_RS23315 (AXW80_23245) | 794..1036 | + | 243 | WP_011069626.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| AXW80_RS23320 (AXW80_23250) | 1026..1313 | + | 288 | WP_005321942.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| AXW80_RS23325 (AXW80_23255) | 1497..2504 | + | 1008 | WP_005321944.1 | replication initiation protein | - |
| AXW80_RS23330 (AXW80_23260) | 3152..3562 | + | 411 | WP_011116719.1 | MobC family plasmid mobilization relaxosome protein | - |
| AXW80_RS23335 (AXW80_23265) | 3612..4229 | + | 618 | Protein_7 | relaxase/mobilization nuclease domain-containing protein | - |
| AXW80_RS23340 (AXW80_23270) | 4267..4800 | + | 534 | WP_011069625.1 | hypothetical protein | - |
| AXW80_RS23345 (AXW80_23275) | 4801..5142 | + | 342 | WP_011116720.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..5430 | 5430 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11356.17 Da Isoelectric Point: 9.9149
>T262329 WP_005321942.1 NZ_CP109911:1026-1313 [Aeromonas salmonicida subsp. salmonicida]
MTFELEFDPRAWKEWKKLGDTVRQQFKKKLAEVLERPRVEANRLHGLPDCYKIKLRGAGYRLVYQVQDDRVLVFVVAVGK
REREQVYLDAGYRLE
MTFELEFDPRAWKEWKKLGDTVRQQFKKKLAEVLERPRVEANRLHGLPDCYKIKLRGAGYRLVYQVQDDRVLVFVVAVGK
REREQVYLDAGYRLE
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A151KDX2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | Q8GMP0 |