Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relE-pasA/RelE-HTH |
Location | 1174..1651 | Replicon | plasmid pAsal3_J227 |
Accession | NZ_CP109910 | ||
Organism | Aeromonas salmonicida subsp. salmonicida strain J227 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A8T8CMR8 |
Locus tag | AXW80_RS23270 | Protein ID | WP_073531821.1 |
Coordinates | 1174..1443 (-) | Length | 90 a.a. |
Antitoxin (Protein)
Gene name | pasA | Uniprot ID | Q7X2E4 |
Locus tag | AXW80_RS23275 | Protein ID | WP_005321784.1 |
Coordinates | 1427..1651 (-) | Length | 75 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
AXW80_RS23265 (AXW80_23195) | 436..1065 | - | 630 | WP_005321764.1 | hypothetical protein | - |
AXW80_RS23270 (AXW80_23200) | 1174..1443 | - | 270 | WP_073531821.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
AXW80_RS23275 (AXW80_23205) | 1427..1651 | - | 225 | WP_005321784.1 | TraY domain-containing protein | Antitoxin |
AXW80_RS23280 (AXW80_23210) | 3433..3849 | - | 417 | WP_269026737.1 | plasmid mobilization relaxosome protein MobC | - |
AXW80_RS23285 (AXW80_23215) | 4465..5490 | - | 1026 | Protein_4 | replication initiation protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | aopP | 1..8322 | 8322 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 90 a.a. Molecular weight: 10358.02 Da Isoelectric Point: 10.3800
>T262328 WP_073531821.1 NZ_CP109910:c1443-1174 [Aeromonas salmonicida subsp. salmonicida]
MAWKVELTDTAKKQLARLDKTQSQRITKYLRRIMMLENPRDAGKALTGNLRTYWRYRVGDYRVVCDIRDNDLVIVAVIIG
HRSEVYGGS
MAWKVELTDTAKKQLARLDKTQSQRITKYLRRIMMLENPRDAGKALTGNLRTYWRYRVGDYRVVCDIRDNDLVIVAVIIG
HRSEVYGGS
Download Length: 270 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|