Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 113876..114516 Replicon plasmid pASal5_J227
Accession NZ_CP109909
Organism Aeromonas salmonicida subsp. salmonicida strain J227

Toxin (Protein)


Gene name vagD Uniprot ID A0A807Z4U5
Locus tag AXW80_RS22900 Protein ID WP_005320982.1
Coordinates 113876..114289 (-) Length 138 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID A0A807Z5T0
Locus tag AXW80_RS22905 Protein ID WP_005320985.1
Coordinates 114286..114516 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
AXW80_RS22865 (AXW80_22800) 109054..109206 - 153 WP_005322083.1 Hok/Gef family protein -
AXW80_RS22870 (AXW80_22805) 109743..110498 - 756 WP_005322068.1 IS21-like element ISAs29 family helper ATPase IstB -
AXW80_RS22875 (AXW80_22810) 110513..112054 - 1542 WP_005322071.1 IS21-like element ISAs29 family transposase -
AXW80_RS22880 (AXW80_22815) 112276..112485 - 210 Protein_123 helix-turn-helix domain-containing protein -
AXW80_RS22885 (AXW80_22820) 112591..112899 - 309 WP_005320974.1 hypothetical protein -
AXW80_RS22890 (AXW80_22825) 112921..113418 - 498 WP_017413137.1 hypothetical protein -
AXW80_RS22895 (AXW80_22830) 113448..113750 - 303 WP_237709758.1 hypothetical protein -
AXW80_RS22900 (AXW80_22835) 113876..114289 - 414 WP_005320982.1 PIN domain-containing protein Toxin
AXW80_RS22905 (AXW80_22840) 114286..114516 - 231 WP_005320985.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
AXW80_RS22910 (AXW80_22845) 114585..114971 - 387 WP_005320988.1 hypothetical protein -
AXW80_RS22915 (AXW80_22850) 116003..116449 + 447 WP_043145058.1 DNA repair protein RadC -
AXW80_RS22920 (AXW80_22855) 116489..116851 + 363 WP_005321010.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid mcr-3.15 / mcr-3.1 ascU / ascT / ascS / ascR / ascQ / ascP / ascO / ascN / aopN / acr1 / acr2 / ascX / ascY / ascV / acrR / acrG / acrV / acrH / aopB / aopD / exsC / exsE / exsB / exsA / exsD / ascB / ascC / ascD / ascE / ascF / ascG / ascH / ascI / ascJ / ascK / ascL / ati1 / ati2 / aopH / sycH / aopO / sycO / ascU / ascT / ascS / ascR / ascR / ascQ / ascP / ascP / ascO / ascN 1..177271 177271


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-42)


Sequences

Toxin        


Download         Length: 138 a.a.        Molecular weight: 14935.23 Da        Isoelectric Point: 5.7146

>T262327 WP_005320982.1 NZ_CP109909:c114289-113876 [Aeromonas salmonicida subsp. salmonicida]
VKTFMLDTCICSFIMREMPQSVLERLGAEVASGNRIVISAITYAEMRYGQIGKKASPKLGPAIDEFVRRLDGILPWDAAT
VDQTLEVRQQLAALGTPIGNNDAAIAAHALTAGCVLVTNNTREFSRVAGLLYEDWVH

Download         Length: 414 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8699.88 Da        Isoelectric Point: 4.7419

>AT262327 WP_005320985.1 NZ_CP109909:c114516-114286 [Aeromonas salmonicida subsp. salmonicida]
MRTVSIFKNGKNQAVRLPKDMEFQGVNDLEIIKNGDTITLRPARPDWFSLAECQKVDADFLQERTDVISDEGRFAL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A807Z4U5

Antitoxin

Source ID Structure
AlphaFold DB A0A807Z5T0

References