Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/upstrm_HI1419-dnstrm_HI1420 |
Location | 2512706..2513317 | Replicon | chromosome |
Accession | NZ_CP109897 | ||
Organism | Xylella fastidiosa subsp. fastidiosa strain XYL461 |
Toxin (Protein)
Gene name | relE | Uniprot ID | Q879T9 |
Locus tag | OK116_RS11535 | Protein ID | WP_011098375.1 |
Coordinates | 2513018..2513317 (-) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | Q879U0 |
Locus tag | OK116_RS11530 | Protein ID | WP_004085003.1 |
Coordinates | 2512706..2513014 (-) | Length | 103 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OK116_RS11495 (OK116_11475) | 2509276..2510037 | - | 762 | WP_004090267.1 | Bax inhibitor-1/YccA family protein | - |
OK116_RS11520 (OK116_11500) | 2511376..2511786 | - | 411 | WP_228446157.1 | hypothetical protein | - |
OK116_RS11525 (OK116_11505) | 2511775..2512632 | + | 858 | WP_228446158.1 | hypothetical protein | - |
OK116_RS11530 (OK116_11510) | 2512706..2513014 | - | 309 | WP_004085003.1 | putative addiction module antidote protein | Antitoxin |
OK116_RS11535 (OK116_11515) | 2513018..2513317 | - | 300 | WP_011098375.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OK116_RS11540 (OK116_11520) | 2513405..2513950 | + | 546 | WP_011098376.1 | hypothetical protein | - |
OK116_RS11545 (OK116_11525) | 2513962..2514105 | + | 144 | WP_155115087.1 | hypothetical protein | - |
OK116_RS11550 (OK116_11530) | 2514258..2514638 | - | 381 | WP_004089371.1 | DUF596 domain-containing protein | - |
OK116_RS11555 (OK116_11535) | 2514643..2515773 | - | 1131 | WP_012382788.1 | DUF769 domain-containing protein | - |
OK116_RS11560 (OK116_11540) | 2516081..2516461 | - | 381 | WP_004087391.1 | DUF596 domain-containing protein | - |
OK116_RS11565 (OK116_11545) | 2516473..2517834 | - | 1362 | WP_012382789.1 | DUF637 domain-containing protein | - |
OK116_RS11570 (OK116_11550) | 2517914..2518057 | + | 144 | WP_155115088.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 2463489..2513767 | 50278 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11378.17 Da Isoelectric Point: 10.3861
>T262326 WP_011098375.1 NZ_CP109897:c2513317-2513018 [Xylella fastidiosa subsp. fastidiosa]
MTYTLKRLEGFSDWLKGLKDGLARQRLIKRLRKVQLGNFGDVQPVGEGVFEMREHFGPGWRMYYVQRGSFLIVMLGGGDK
STQQSDIRRAIELAKSLED
MTYTLKRLEGFSDWLKGLKDGLARQRLIKRLRKVQLGNFGDVQPVGEGVFEMREHFGPGWRMYYVQRGSFLIVMLGGGDK
STQQSDIRRAIELAKSLED
Download Length: 300 bp
Antitoxin
Download Length: 103 a.a. Molecular weight: 11060.61 Da Isoelectric Point: 4.6535
>AT262326 WP_004085003.1 NZ_CP109897:c2513014-2512706 [Xylella fastidiosa subsp. fastidiosa]
VTITKKINVSELPEFDAAEYLNSEEEVAAYLTAVLEENDPALLAAALGDIARSRGMSQIAKDSGITREALYKALRPGSEP
RFDTISRVCTALGIRLVAQPMH
VTITKKINVSELPEFDAAEYLNSEEEVAAYLTAVLEENDPALLAAALGDIARSRGMSQIAKDSGITREALYKALRPGSEP
RFDTISRVCTALGIRLVAQPMH
Download Length: 309 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q879T9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A060HCD4 |