Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/-
Location 1581567..1582153 Replicon chromosome
Accession NZ_CP109897
Organism Xylella fastidiosa subsp. fastidiosa strain XYL461

Toxin (Protein)


Gene name hicA Uniprot ID Q87BV5
Locus tag OK116_RS07450 Protein ID WP_004089517.1
Coordinates 1581899..1582153 (-) Length 85 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID B2I6C9
Locus tag OK116_RS07445 Protein ID WP_004085025.1
Coordinates 1581567..1581902 (-) Length 112 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OK116_RS07415 (OK116_07410) 1577166..1578077 - 912 WP_004089529.1 iron-sulfur cluster carrier protein ApbC -
OK116_RS07420 (OK116_07415) 1578512..1579285 + 774 WP_004089528.1 3-deoxy-manno-octulosonate cytidylyltransferase -
OK116_RS07425 (OK116_07420) 1579282..1579746 + 465 WP_011098056.1 low molecular weight protein-tyrosine-phosphatase -
OK116_RS07430 (OK116_07425) 1579733..1580446 - 714 WP_011098057.1 site-specific DNA-methyltransferase -
OK116_RS07435 (OK116_07430) 1580797..1581078 + 282 WP_011098058.1 type II toxin-antitoxin system RelE/ParE family toxin -
OK116_RS07440 (OK116_07435) 1581088..1581387 + 300 WP_004089519.1 HigA family addiction module antitoxin -
OK116_RS07445 (OK116_07440) 1581567..1581902 - 336 WP_004085025.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
OK116_RS07450 (OK116_07445) 1581899..1582153 - 255 WP_004089517.1 type II toxin-antitoxin system HicA family toxin Toxin
OK116_RS07455 (OK116_07450) 1582206..1582904 - 699 WP_011098059.1 hypothetical protein -
OK116_RS07460 (OK116_07455) 1583033..1583494 - 462 WP_011098060.1 hypothetical protein -
OK116_RS07465 (OK116_07460) 1583491..1584180 - 690 WP_011098061.1 hypothetical protein -
OK116_RS07470 (OK116_07465) 1584161..1585267 - 1107 WP_012382665.1 YdaU family protein -
OK116_RS07475 (OK116_07470) 1585264..1585518 - 255 WP_012382666.1 hypothetical protein -
OK116_RS07480 (OK116_07475) 1585665..1586039 + 375 WP_004091110.1 conjugal transfer protein -
OK116_RS07485 (OK116_07480) 1586045..1586650 + 606 WP_128712521.1 conjugal transfer protein TrbN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(23-80)

Antitoxin

Uncharacterised protein family HicB

(55-105)


Sequences

Toxin        


Download         Length: 85 a.a.        Molecular weight: 9639.14 Da        Isoelectric Point: 11.2766

>T262325 WP_004089517.1 NZ_CP109897:c1582153-1581899 [Xylella fastidiosa subsp. fastidiosa]
MKRKHAKTLSAIYTRPVSANIQWRDIEALFVELGAKVEEREGSRMLVRLFGERRIFHRPHPSPNTDKGAVESIRAWLKSN
GVTP

Download         Length: 255 bp

Antitoxin


Download         Length: 112 a.a.        Molecular weight: 12324.07 Da        Isoelectric Point: 5.6556

>AT262325 WP_004085025.1 NZ_CP109897:c1581902-1581567 [Xylella fastidiosa subsp. fastidiosa]
MKNIMTIESFKAIITYDPEIDMFRGEFVGINGGADFYAKDLKGLRREGAISLKVFLEACKEDSVEPRKCYSGKFNARISP
ELHALASEAAAAQGISLNQFVEQAIQHEVHT

Download         Length: 336 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q87BV5

Antitoxin

Source ID Structure
AlphaFold DB A0A060HAK5

References