Detailed information of TA system    

insolicoBioinformatically predicted

Overview


TA module


Type II Classification (family/domain) pasABC/RelE-HTH
Location 1392520..1392997 Replicon chromosome
Accession NZ_CP109897
Organism Xylella fastidiosa subsp. fastidiosa strain XYL461

Toxin (Protein)


Gene name pasB Uniprot ID Q87CA4
Locus tag OK116_RS06590 Protein ID WP_011097988.1
Coordinates 1392731..1392997 (+) Length 89 a.a.

Antitoxin (Protein)


Gene name pasA Uniprot ID A0A7G7TPD2
Locus tag OK116_RS06585 Protein ID WP_004091377.1
Coordinates 1392520..1392747 (+) Length 76 a.a.

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OK116_RS06545 (OK116_06540) 1387647..1388792 - 1146 WP_011097984.1 baseplate J/gp47 family protein -
OK116_RS06550 (OK116_06545) 1388891..1389187 + 297 WP_004089252.1 type II toxin-antitoxin system RelE/ParE family toxin -
OK116_RS06555 (OK116_06550) 1389191..1389496 + 306 WP_004089254.1 putative addiction module antidote protein -
OK116_RS06560 (OK116_06555) 1389507..1389860 - 354 WP_011097986.1 hypothetical protein -
OK116_RS06565 (OK116_06560) 1389857..1390498 - 642 WP_004090764.1 Gp138 family membrane-puncturing spike protein -
OK116_RS06570 (OK116_06565) 1390495..1391325 - 831 WP_004090766.1 hypothetical protein -
OK116_RS06575 (OK116_06570) 1391322..1391639 - 318 WP_011097873.1 hypothetical protein -
OK116_RS06580 (OK116_06575) 1391639..1392409 - 771 WP_004090769.1 hypothetical protein -
OK116_RS06585 (OK116_06580) 1392520..1392747 + 228 WP_004091377.1 DUF6290 family protein Antitoxin
OK116_RS06590 (OK116_06585) 1392731..1392997 + 267 WP_011097988.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
OK116_RS06595 (OK116_06590) 1393008..1394801 - 1794 WP_228446142.1 phage tail tape measure protein -
OK116_RS06600 (OK116_06600) 1395045..1395467 - 423 WP_004085005.1 putative phage tail assembly chaperone -
OK116_RS06605 (OK116_06605) 1395464..1395901 - 438 WP_011097990.1 DUF3277 family protein -
OK116_RS06610 (OK116_06610) 1395911..1396144 - 234 WP_011097991.1 DUF3383 family protein -
OK116_RS06615 (OK116_06615) 1396161..1397039 - 879 WP_012382645.1 RNA-guided endonuclease TnpB family protein -
OK116_RS06620 (OK116_06620) 1397205..1397366 - 162 WP_014607806.1 helix-turn-helix domain-containing protein -
OK116_RS06625 (OK116_06625) 1397360..1397965 - 606 Protein_1247 IS607 family transposase -

Associated MGEs


MGE
detail
Similar
MGEs
Relative
position
MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1385842..1404141 18299
- flank IS/Tn - - 1397360..1397581 221


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.



Sequences


Toxin        


Download         Length: 89 a.a.        Molecular weight: 10163.79 Da        Isoelectric Point: 10.6086

>T262324 WP_011097988.1 NZ_CP109897:1392731-1392997 [Xylella fastidiosa subsp. fastidiosa]
MAWTIDYTDTAKQQLRKLDKHMARRIVDFMDERIAGLENPRSSGKALTGPLGGFWRYRVGDFRVVCAIQDSVLRVLVVRV
GHRGEIYR

Download         Length: 267 bp


Antitoxin


Download         Length: 76 a.a.        Molecular weight: 8615.63 Da        Isoelectric Point: 5.0958

>AT262324 WP_004091377.1 NZ_CP109897:1392520-1392747 [Xylella fastidiosa subsp. fastidiosa]
MATSIRLSPEMEQRLNSLASHTGRTKAYYLREIIEHGIEEMEDYYLAADVLERVRHGQEQVHSAADVRKTLGLDD

Download         Length: 228 bp


Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures


Toxin

Source ID Structure
AlphaFold DB A0A060HDH1


Antitoxin

Source ID Structure
AlphaFold DB A0A7G7TPD2

References