Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) PumA-relB/COG3657-DUF971
Location 1388891..1389496 Replicon chromosome
Accession NZ_CP109897
Organism Xylella fastidiosa subsp. fastidiosa strain XYL461

Toxin (Protein)


Gene name PumA Uniprot ID B2I5N3
Locus tag OK116_RS06550 Protein ID WP_004089252.1
Coordinates 1388891..1389187 (+) Length 99 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag OK116_RS06555 Protein ID WP_004089254.1
Coordinates 1389191..1389496 (+) Length 102 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OK116_RS06525 (OK116_06520) 1384056..1385033 + 978 WP_004087353.1 hypothetical protein -
OK116_RS06530 (OK116_06525) 1385292..1385738 + 447 WP_004087355.1 hypothetical protein -
OK116_RS06535 (OK116_06530) 1385842..1387086 - 1245 WP_011097983.1 tail fiber protein -
OK116_RS06540 (OK116_06535) 1387090..1387650 - 561 WP_011097869.1 DUF2612 domain-containing protein -
OK116_RS06545 (OK116_06540) 1387647..1388792 - 1146 WP_011097984.1 baseplate J/gp47 family protein -
OK116_RS06550 (OK116_06545) 1388891..1389187 + 297 WP_004089252.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
OK116_RS06555 (OK116_06550) 1389191..1389496 + 306 WP_004089254.1 putative addiction module antidote protein Antitoxin
OK116_RS06560 (OK116_06555) 1389507..1389860 - 354 WP_011097986.1 hypothetical protein -
OK116_RS06565 (OK116_06560) 1389857..1390498 - 642 WP_004090764.1 Gp138 family membrane-puncturing spike protein -
OK116_RS06570 (OK116_06565) 1390495..1391325 - 831 WP_004090766.1 hypothetical protein -
OK116_RS06575 (OK116_06570) 1391322..1391639 - 318 WP_011097873.1 hypothetical protein -
OK116_RS06580 (OK116_06575) 1391639..1392409 - 771 WP_004090769.1 hypothetical protein -
OK116_RS06585 (OK116_06580) 1392520..1392747 + 228 WP_004091377.1 DUF6290 family protein -
OK116_RS06590 (OK116_06585) 1392731..1392997 + 267 WP_011097988.1 type II toxin-antitoxin system RelE/ParE family toxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1385842..1404141 18299


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Addiction module killer protein, predicted

(1-94)

Antitoxin

Cro/C1-type helix-turn-helix domain

(49-95)


Sequences

Toxin        


Download         Length: 99 a.a.        Molecular weight: 10790.57 Da        Isoelectric Point: 10.0509

>T262323 WP_004089252.1 NZ_CP109897:1388891-1389187 [Xylella fastidiosa subsp. fastidiosa]
MVELIKTSTFDAWINSLRDRKAAARIQARLDRLALGNPGDVKPVGAGISEMRIDHGPGYRIYFMKHGAVLILLLCGGDKS
SQVRDIEQAKALAALWKD

Download         Length: 297 bp

Antitoxin


Download         Length: 102 a.a.        Molecular weight: 10983.37 Da        Isoelectric Point: 5.0941

>AT262323 WP_004089254.1 NZ_CP109897:1389191-1389496 [Xylella fastidiosa subsp. fastidiosa]
MNNETFSRYDTADYLKTEEDIAAYMEAVMEEGGRDNPAFIARALGAVARARNLSQLARDVGMSRQGLDKALSNDGNPSFS
TILKVAKALGLRMSFTPSSMS

Download         Length: 306 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A060HBK9

Antitoxin

Source ID Structure

References