Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relE-dinJ/YafQ-RelB
Location 1307606..1308137 Replicon chromosome
Accession NZ_CP109897
Organism Xylella fastidiosa subsp. fastidiosa strain XYL461

Toxin (Protein)


Gene name relE Uniprot ID Q87CH1
Locus tag OK116_RS06110 Protein ID WP_004090909.1
Coordinates 1307856..1308137 (+) Length 94 a.a.

Antitoxin (Protein)


Gene name dinJ Uniprot ID Q87CH2
Locus tag OK116_RS06105 Protein ID WP_004090907.1
Coordinates 1307606..1307869 (+) Length 88 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OK116_RS06080 (OK116_06080) 1302832..1304010 - 1179 WP_011097931.1 phage tail sheath family protein -
OK116_RS06085 (OK116_06085) 1304075..1305667 - 1593 WP_012382617.1 tail fiber domain-containing protein -
OK116_RS06090 (OK116_06090) 1305675..1306232 - 558 WP_011097610.1 phage tail protein I -
OK116_RS06095 (OK116_06095) 1306225..1307118 - 894 WP_011097611.1 baseplate J/gp47 family protein -
OK116_RS06100 (OK116_06100) 1307118..1307480 - 363 WP_014607615.1 GPW/gp25 family protein -
OK116_RS06105 (OK116_06105) 1307606..1307869 + 264 WP_004090907.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
OK116_RS06110 (OK116_06110) 1307856..1308137 + 282 WP_004090909.1 type II toxin-antitoxin system YafQ family toxin Toxin
OK116_RS06115 (OK116_06115) 1308174..1308761 - 588 WP_011097612.1 phage baseplate assembly protein V -
OK116_RS06120 (OK116_06120) 1308758..1309300 - 543 WP_011097613.1 hypothetical protein -
OK116_RS06125 (OK116_06125) 1309276..1309797 - 522 WP_011097614.1 hypothetical protein -
OK116_RS06130 (OK116_06130) 1309794..1310117 - 324 WP_012382618.1 hypothetical protein -
OK116_RS06135 (OK116_06135) 1310117..1310377 - 261 WP_012382619.1 hypothetical protein -
OK116_RS06140 (OK116_06140) 1310395..1312269 - 1875 WP_012382620.1 phage major capsid protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1294193..1340915 46722


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-91)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(4-70)


Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 10936.37 Da        Isoelectric Point: 7.2205

>T262322 WP_004090909.1 NZ_CP109897:1307856-1308137 [Xylella fastidiosa subsp. fastidiosa]
MRRISQTGQFKRDYKREAKGQHRATLDEELIHVLEALTCDHPLEPRHHDHALTGDWKDHRDCHIKPDLVLIYRKPDNETL
QLVRIGSHSELGL

Download         Length: 282 bp

Antitoxin


Download         Length: 88 a.a.        Molecular weight: 9495.95 Da        Isoelectric Point: 5.6033

>AT262322 WP_004090907.1 NZ_CP109897:1307606-1307869 [Xylella fastidiosa subsp. fastidiosa]
MSANAVVRARVDAHIKEEASTVLATMGLSVSDAFRMMLTRIAREKALPFEPLVPNETTIAAMREARAGHLKSFDSIEALM
ADLHAED

Download         Length: 264 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q87CH1

Antitoxin

Source ID Structure
AlphaFold DB Q87CH2

References