Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | FicTA/Fic(toxin) |
| Location | 1216734..1217530 | Replicon | chromosome |
| Accession | NZ_CP109897 | ||
| Organism | Xylella fastidiosa subsp. fastidiosa strain XYL461 | ||
Toxin (Protein)
| Gene name | VbhT | Uniprot ID | Q87CQ8 |
| Locus tag | OK116_RS05600 | Protein ID | WP_004088112.1 |
| Coordinates | 1216734..1217345 (-) | Length | 204 a.a. |
Antitoxin (Protein)
| Gene name | VbhA | Uniprot ID | B2I551 |
| Locus tag | OK116_RS05605 | Protein ID | WP_004088114.1 |
| Coordinates | 1217342..1217530 (-) | Length | 63 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OK116_RS05555 (OK116_05555) | 1212189..1213076 | - | 888 | WP_012382597.1 | YdaU family protein | - |
| OK116_RS05560 (OK116_05560) | 1213073..1213861 | - | 789 | WP_011097897.1 | Bro-N domain-containing protein | - |
| OK116_RS05565 (OK116_05565) | 1213858..1214490 | - | 633 | WP_004088094.1 | Bro-N domain-containing protein | - |
| OK116_RS05570 (OK116_05570) | 1214487..1214750 | - | 264 | WP_228446177.1 | hypothetical protein | - |
| OK116_RS05575 (OK116_05575) | 1214768..1214983 | - | 216 | WP_012382598.1 | hypothetical protein | - |
| OK116_RS05580 (OK116_05580) | 1215013..1215201 | - | 189 | WP_004088102.1 | hypothetical protein | - |
| OK116_RS05585 (OK116_05585) | 1215229..1215420 | - | 192 | WP_004088104.1 | hypothetical protein | - |
| OK116_RS05590 (OK116_05590) | 1215679..1215924 | - | 246 | WP_004088108.1 | hypothetical protein | - |
| OK116_RS05595 (OK116_05595) | 1216009..1216683 | + | 675 | WP_012382600.1 | helix-turn-helix transcriptional regulator | - |
| OK116_RS05600 (OK116_05600) | 1216734..1217345 | - | 612 | WP_004088112.1 | Fic/DOC family protein | Toxin |
| OK116_RS05605 (OK116_05605) | 1217342..1217530 | - | 189 | WP_004088114.1 | antitoxin VbhA family protein | Antitoxin |
| OK116_RS05610 (OK116_05610) | 1217922..1218458 | + | 537 | WP_012382601.1 | hypothetical protein | - |
| OK116_RS05615 (OK116_05615) | 1218455..1218868 | + | 414 | WP_004088056.1 | DUF1566 domain-containing protein | - |
| OK116_RS05620 (OK116_05620) | 1218865..1219266 | + | 402 | WP_004088054.1 | hypothetical protein | - |
| OK116_RS05625 (OK116_05625) | 1219263..1219412 | + | 150 | WP_012382602.1 | hypothetical protein | - |
| OK116_RS05630 (OK116_05630) | 1219630..1219776 | + | 147 | WP_225621633.1 | hypothetical protein | - |
| OK116_RS05635 (OK116_05635) | 1219799..1219990 | + | 192 | WP_012382603.1 | hypothetical protein | - |
| OK116_RS05640 (OK116_05640) | 1220011..1220355 | + | 345 | WP_004088346.1 | hypothetical protein | - |
| OK116_RS05645 (OK116_05645) | 1220395..1221216 | + | 822 | WP_004088345.1 | DUF2303 family protein | - |
| OK116_RS05650 (OK116_05650) | 1221232..1222158 | + | 927 | WP_004088344.1 | phage recombination protein Bet | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1203831..1227280 | 23449 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 204 a.a. Molecular weight: 22832.60 Da Isoelectric Point: 5.1271
>T262321 WP_004088112.1 NZ_CP109897:c1217345-1216734 [Xylella fastidiosa subsp. fastidiosa]
MKYAGDRGDPYLDSETGVLRNLLGIRDQGGLDKIESTLSFLRTSELRERPVKGKFDLAHLQEIHNRLFQDVYDWAGQIRQ
VEISKGNTMFAQQIAIQSAAQQIFGQLAKERFLCGLDAEEFSKRAGDYLGEINVLHPFREGNGRTQREFIAQLAQRAGYR
IDWGVVSQADMIKASIDAYNGDSSGLASIIREGISDQLFKDNE
MKYAGDRGDPYLDSETGVLRNLLGIRDQGGLDKIESTLSFLRTSELRERPVKGKFDLAHLQEIHNRLFQDVYDWAGQIRQ
VEISKGNTMFAQQIAIQSAAQQIFGQLAKERFLCGLDAEEFSKRAGDYLGEINVLHPFREGNGRTQREFIAQLAQRAGYR
IDWGVVSQADMIKASIDAYNGDSSGLASIIREGISDQLFKDNE
Download Length: 612 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|