Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) FicTA/Fic(toxin)
Location 1216734..1217530 Replicon chromosome
Accession NZ_CP109897
Organism Xylella fastidiosa subsp. fastidiosa strain XYL461

Toxin (Protein)


Gene name VbhT Uniprot ID Q87CQ8
Locus tag OK116_RS05600 Protein ID WP_004088112.1
Coordinates 1216734..1217345 (-) Length 204 a.a.

Antitoxin (Protein)


Gene name VbhA Uniprot ID B2I551
Locus tag OK116_RS05605 Protein ID WP_004088114.1
Coordinates 1217342..1217530 (-) Length 63 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OK116_RS05555 (OK116_05555) 1212189..1213076 - 888 WP_012382597.1 YdaU family protein -
OK116_RS05560 (OK116_05560) 1213073..1213861 - 789 WP_011097897.1 Bro-N domain-containing protein -
OK116_RS05565 (OK116_05565) 1213858..1214490 - 633 WP_004088094.1 Bro-N domain-containing protein -
OK116_RS05570 (OK116_05570) 1214487..1214750 - 264 WP_228446177.1 hypothetical protein -
OK116_RS05575 (OK116_05575) 1214768..1214983 - 216 WP_012382598.1 hypothetical protein -
OK116_RS05580 (OK116_05580) 1215013..1215201 - 189 WP_004088102.1 hypothetical protein -
OK116_RS05585 (OK116_05585) 1215229..1215420 - 192 WP_004088104.1 hypothetical protein -
OK116_RS05590 (OK116_05590) 1215679..1215924 - 246 WP_004088108.1 hypothetical protein -
OK116_RS05595 (OK116_05595) 1216009..1216683 + 675 WP_012382600.1 helix-turn-helix transcriptional regulator -
OK116_RS05600 (OK116_05600) 1216734..1217345 - 612 WP_004088112.1 Fic/DOC family protein Toxin
OK116_RS05605 (OK116_05605) 1217342..1217530 - 189 WP_004088114.1 antitoxin VbhA family protein Antitoxin
OK116_RS05610 (OK116_05610) 1217922..1218458 + 537 WP_012382601.1 hypothetical protein -
OK116_RS05615 (OK116_05615) 1218455..1218868 + 414 WP_004088056.1 DUF1566 domain-containing protein -
OK116_RS05620 (OK116_05620) 1218865..1219266 + 402 WP_004088054.1 hypothetical protein -
OK116_RS05625 (OK116_05625) 1219263..1219412 + 150 WP_012382602.1 hypothetical protein -
OK116_RS05630 (OK116_05630) 1219630..1219776 + 147 WP_225621633.1 hypothetical protein -
OK116_RS05635 (OK116_05635) 1219799..1219990 + 192 WP_012382603.1 hypothetical protein -
OK116_RS05640 (OK116_05640) 1220011..1220355 + 345 WP_004088346.1 hypothetical protein -
OK116_RS05645 (OK116_05645) 1220395..1221216 + 822 WP_004088345.1 DUF2303 family protein -
OK116_RS05650 (OK116_05650) 1221232..1222158 + 927 WP_004088344.1 phage recombination protein Bet -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1203831..1227280 23449


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(55-152)

Antitoxin

Antitoxin VbhA

(10-56)


Sequences

Toxin        


Download         Length: 204 a.a.        Molecular weight: 22832.60 Da        Isoelectric Point: 5.1271

>T262321 WP_004088112.1 NZ_CP109897:c1217345-1216734 [Xylella fastidiosa subsp. fastidiosa]
MKYAGDRGDPYLDSETGVLRNLLGIRDQGGLDKIESTLSFLRTSELRERPVKGKFDLAHLQEIHNRLFQDVYDWAGQIRQ
VEISKGNTMFAQQIAIQSAAQQIFGQLAKERFLCGLDAEEFSKRAGDYLGEINVLHPFREGNGRTQREFIAQLAQRAGYR
IDWGVVSQADMIKASIDAYNGDSSGLASIIREGISDQLFKDNE

Download         Length: 612 bp

Antitoxin


Download         Length: 63 a.a.        Molecular weight: 6837.77 Da        Isoelectric Point: 4.9859

>AT262321 WP_004088114.1 NZ_CP109897:c1217530-1217342 [Xylella fastidiosa subsp. fastidiosa]
MLTDHEKAERRAVVQSALASQRIEGLEPDAQAVVDAECWARGEMTIAAAVDQYKARVRLQIA

Download         Length: 189 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q87CQ8

Antitoxin

Source ID Structure
AlphaFold DB B2I551

References