Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/upstrm_HI1419-dnstrm_HI1420 |
Location | 2506858..2507469 | Replicon | chromosome |
Accession | NZ_CP109894 | ||
Organism | Xylella fastidiosa subsp. fastidiosa strain CFBP8351 |
Toxin (Protein)
Gene name | relE | Uniprot ID | Q879T9 |
Locus tag | OK118_RS11315 | Protein ID | WP_011098375.1 |
Coordinates | 2507170..2507469 (-) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | Q879U0 |
Locus tag | OK118_RS11310 | Protein ID | WP_004085003.1 |
Coordinates | 2506858..2507166 (-) | Length | 103 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OK118_RS11275 (OK118_11270) | 2503428..2504189 | - | 762 | WP_004090267.1 | Bax inhibitor-1/YccA family protein | - |
OK118_RS11300 (OK118_11295) | 2505528..2505938 | - | 411 | WP_228446157.1 | hypothetical protein | - |
OK118_RS11305 (OK118_11300) | 2505927..2506784 | + | 858 | WP_228446158.1 | hypothetical protein | - |
OK118_RS11310 (OK118_11305) | 2506858..2507166 | - | 309 | WP_004085003.1 | putative addiction module antidote protein | Antitoxin |
OK118_RS11315 (OK118_11310) | 2507170..2507469 | - | 300 | WP_011098375.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OK118_RS11320 (OK118_11315) | 2507557..2508102 | + | 546 | WP_011098376.1 | hypothetical protein | - |
OK118_RS11325 (OK118_11320) | 2508114..2508257 | + | 144 | WP_155115087.1 | hypothetical protein | - |
OK118_RS11330 (OK118_11325) | 2508410..2508790 | - | 381 | WP_004089371.1 | DUF596 domain-containing protein | - |
OK118_RS11335 (OK118_11330) | 2508795..2509925 | - | 1131 | WP_012382788.1 | DUF769 domain-containing protein | - |
OK118_RS11340 (OK118_11335) | 2510233..2510613 | - | 381 | WP_004087391.1 | DUF596 domain-containing protein | - |
OK118_RS11345 (OK118_11340) | 2510625..2511986 | - | 1362 | WP_012382789.1 | DUF637 domain-containing protein | - |
OK118_RS11350 (OK118_11345) | 2512066..2512209 | + | 144 | WP_155115088.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 2460326..2507919 | 47593 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11378.17 Da Isoelectric Point: 10.3861
>T262317 WP_011098375.1 NZ_CP109894:c2507469-2507170 [Xylella fastidiosa subsp. fastidiosa]
MTYTLKRLEGFSDWLKGLKDGLARQRLIKRLRKVQLGNFGDVQPVGEGVFEMREHFGPGWRMYYVQRGSFLIVMLGGGDK
STQQSDIRRAIELAKSLED
MTYTLKRLEGFSDWLKGLKDGLARQRLIKRLRKVQLGNFGDVQPVGEGVFEMREHFGPGWRMYYVQRGSFLIVMLGGGDK
STQQSDIRRAIELAKSLED
Download Length: 300 bp
Antitoxin
Download Length: 103 a.a. Molecular weight: 11060.61 Da Isoelectric Point: 4.6535
>AT262317 WP_004085003.1 NZ_CP109894:c2507166-2506858 [Xylella fastidiosa subsp. fastidiosa]
VTITKKINVSELPEFDAAEYLNSEEEVAAYLTAVLEENDPALLAAALGDIARSRGMSQIAKDSGITREALYKALRPGSEP
RFDTISRVCTALGIRLVAQPMH
VTITKKINVSELPEFDAAEYLNSEEEVAAYLTAVLEENDPALLAAALGDIARSRGMSQIAKDSGITREALYKALRPGSEP
RFDTISRVCTALGIRLVAQPMH
Download Length: 309 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q879T9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A060HCD4 |