Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/-
Location 1581793..1582379 Replicon chromosome
Accession NZ_CP109894
Organism Xylella fastidiosa subsp. fastidiosa strain CFBP8351

Toxin (Protein)


Gene name hicA Uniprot ID Q87BV5
Locus tag OK118_RS07245 Protein ID WP_004089517.1
Coordinates 1582125..1582379 (-) Length 85 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID B2I6C9
Locus tag OK118_RS07240 Protein ID WP_004085025.1
Coordinates 1581793..1582128 (-) Length 112 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OK118_RS07210 (OK118_07210) 1577392..1578303 - 912 WP_004089529.1 iron-sulfur cluster carrier protein ApbC -
OK118_RS07215 (OK118_07215) 1578738..1579511 + 774 WP_004089528.1 3-deoxy-manno-octulosonate cytidylyltransferase -
OK118_RS07220 (OK118_07220) 1579508..1579972 + 465 WP_011098056.1 low molecular weight protein-tyrosine-phosphatase -
OK118_RS07225 (OK118_07225) 1579959..1580672 - 714 WP_011098057.1 site-specific DNA-methyltransferase -
OK118_RS07230 (OK118_07230) 1581023..1581304 + 282 WP_011098058.1 type II toxin-antitoxin system RelE/ParE family toxin -
OK118_RS07235 (OK118_07235) 1581314..1581613 + 300 WP_004089519.1 HigA family addiction module antitoxin -
OK118_RS07240 (OK118_07240) 1581793..1582128 - 336 WP_004085025.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
OK118_RS07245 (OK118_07245) 1582125..1582379 - 255 WP_004089517.1 type II toxin-antitoxin system HicA family toxin Toxin
OK118_RS07250 (OK118_07250) 1582432..1583130 - 699 WP_011098059.1 hypothetical protein -
OK118_RS07255 (OK118_07255) 1583259..1583720 - 462 WP_011098060.1 hypothetical protein -
OK118_RS07260 (OK118_07260) 1583717..1584406 - 690 WP_011098061.1 hypothetical protein -
OK118_RS07265 (OK118_07265) 1584387..1585493 - 1107 WP_012382665.1 YdaU family protein -
OK118_RS07270 (OK118_07270) 1585490..1585744 - 255 WP_012382666.1 hypothetical protein -
OK118_RS07275 (OK118_07275) 1585891..1586265 + 375 WP_004091110.1 conjugal transfer protein -
OK118_RS07280 (OK118_07280) 1586271..1586876 + 606 WP_004091108.1 conjugal transfer protein TrbN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(23-80)

Antitoxin

Uncharacterised protein family HicB

(55-105)


Sequences

Toxin        


Download         Length: 85 a.a.        Molecular weight: 9639.14 Da        Isoelectric Point: 11.2766

>T262316 WP_004089517.1 NZ_CP109894:c1582379-1582125 [Xylella fastidiosa subsp. fastidiosa]
MKRKHAKTLSAIYTRPVSANIQWRDIEALFVELGAKVEEREGSRMLVRLFGERRIFHRPHPSPNTDKGAVESIRAWLKSN
GVTP

Download         Length: 255 bp

Antitoxin


Download         Length: 112 a.a.        Molecular weight: 12324.07 Da        Isoelectric Point: 5.6556

>AT262316 WP_004085025.1 NZ_CP109894:c1582128-1581793 [Xylella fastidiosa subsp. fastidiosa]
MKNIMTIESFKAIITYDPEIDMFRGEFVGINGGADFYAKDLKGLRREGAISLKVFLEACKEDSVEPRKCYSGKFNARISP
ELHALASEAAAAQGISLNQFVEQAIQHEVHT

Download         Length: 336 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q87BV5

Antitoxin

Source ID Structure
AlphaFold DB A0A060HAK5

References