Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/- |
Location | 1581793..1582379 | Replicon | chromosome |
Accession | NZ_CP109894 | ||
Organism | Xylella fastidiosa subsp. fastidiosa strain CFBP8351 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | Q87BV5 |
Locus tag | OK118_RS07245 | Protein ID | WP_004089517.1 |
Coordinates | 1582125..1582379 (-) | Length | 85 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | B2I6C9 |
Locus tag | OK118_RS07240 | Protein ID | WP_004085025.1 |
Coordinates | 1581793..1582128 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OK118_RS07210 (OK118_07210) | 1577392..1578303 | - | 912 | WP_004089529.1 | iron-sulfur cluster carrier protein ApbC | - |
OK118_RS07215 (OK118_07215) | 1578738..1579511 | + | 774 | WP_004089528.1 | 3-deoxy-manno-octulosonate cytidylyltransferase | - |
OK118_RS07220 (OK118_07220) | 1579508..1579972 | + | 465 | WP_011098056.1 | low molecular weight protein-tyrosine-phosphatase | - |
OK118_RS07225 (OK118_07225) | 1579959..1580672 | - | 714 | WP_011098057.1 | site-specific DNA-methyltransferase | - |
OK118_RS07230 (OK118_07230) | 1581023..1581304 | + | 282 | WP_011098058.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
OK118_RS07235 (OK118_07235) | 1581314..1581613 | + | 300 | WP_004089519.1 | HigA family addiction module antitoxin | - |
OK118_RS07240 (OK118_07240) | 1581793..1582128 | - | 336 | WP_004085025.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
OK118_RS07245 (OK118_07245) | 1582125..1582379 | - | 255 | WP_004089517.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
OK118_RS07250 (OK118_07250) | 1582432..1583130 | - | 699 | WP_011098059.1 | hypothetical protein | - |
OK118_RS07255 (OK118_07255) | 1583259..1583720 | - | 462 | WP_011098060.1 | hypothetical protein | - |
OK118_RS07260 (OK118_07260) | 1583717..1584406 | - | 690 | WP_011098061.1 | hypothetical protein | - |
OK118_RS07265 (OK118_07265) | 1584387..1585493 | - | 1107 | WP_012382665.1 | YdaU family protein | - |
OK118_RS07270 (OK118_07270) | 1585490..1585744 | - | 255 | WP_012382666.1 | hypothetical protein | - |
OK118_RS07275 (OK118_07275) | 1585891..1586265 | + | 375 | WP_004091110.1 | conjugal transfer protein | - |
OK118_RS07280 (OK118_07280) | 1586271..1586876 | + | 606 | WP_004091108.1 | conjugal transfer protein TrbN | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 85 a.a. Molecular weight: 9639.14 Da Isoelectric Point: 11.2766
>T262316 WP_004089517.1 NZ_CP109894:c1582379-1582125 [Xylella fastidiosa subsp. fastidiosa]
MKRKHAKTLSAIYTRPVSANIQWRDIEALFVELGAKVEEREGSRMLVRLFGERRIFHRPHPSPNTDKGAVESIRAWLKSN
GVTP
MKRKHAKTLSAIYTRPVSANIQWRDIEALFVELGAKVEEREGSRMLVRLFGERRIFHRPHPSPNTDKGAVESIRAWLKSN
GVTP
Download Length: 255 bp
Antitoxin
Download Length: 112 a.a. Molecular weight: 12324.07 Da Isoelectric Point: 5.6556
>AT262316 WP_004085025.1 NZ_CP109894:c1582128-1581793 [Xylella fastidiosa subsp. fastidiosa]
MKNIMTIESFKAIITYDPEIDMFRGEFVGINGGADFYAKDLKGLRREGAISLKVFLEACKEDSVEPRKCYSGKFNARISP
ELHALASEAAAAQGISLNQFVEQAIQHEVHT
MKNIMTIESFKAIITYDPEIDMFRGEFVGINGGADFYAKDLKGLRREGAISLKVFLEACKEDSVEPRKCYSGKFNARISP
ELHALASEAAAAQGISLNQFVEQAIQHEVHT
Download Length: 336 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q87BV5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A060HAK5 |