262315

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) pasABC/RelE-HTH
Location 1392728..1393205 Replicon chromosome
Accession NZ_CP109894
Organism Xylella fastidiosa subsp. fastidiosa strain CFBP8351

Toxin (Protein)


Gene name pasB Uniprot ID Q87CA4
Locus tag OK118_RS06375 Protein ID WP_011097988.1
Coordinates 1392939..1393205 (+) Length 89 a.a.

Antitoxin (Protein)


Gene name pasA Uniprot ID A0A7G7TPD2
Locus tag OK118_RS06370 Protein ID WP_004091377.1
Coordinates 1392728..1392955 (+) Length 76 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OK118_RS06330 (OK118_06330) 1387855..1389000 - 1146 WP_011097984.1 baseplate J/gp47 family protein -
OK118_RS06335 (OK118_06335) 1389099..1389395 + 297 WP_004089252.1 type II toxin-antitoxin system RelE/ParE family toxin -
OK118_RS06340 (OK118_06340) 1389399..1389704 + 306 WP_004089254.1 putative addiction module antidote protein -
OK118_RS06345 (OK118_06345) 1389715..1390068 - 354 WP_011097986.1 hypothetical protein -
OK118_RS06350 (OK118_06350) 1390065..1390706 - 642 WP_004090764.1 Gp138 family membrane-puncturing spike protein -
OK118_RS06355 (OK118_06355) 1390703..1391533 - 831 WP_004090766.1 hypothetical protein -
OK118_RS06360 (OK118_06360) 1391530..1391847 - 318 WP_011097873.1 hypothetical protein -
OK118_RS06365 (OK118_06365) 1391847..1392617 - 771 WP_004090769.1 hypothetical protein -
OK118_RS06370 (OK118_06370) 1392728..1392955 + 228 WP_004091377.1 DUF6290 family protein Antitoxin
OK118_RS06375 (OK118_06375) 1392939..1393205 + 267 WP_011097988.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
OK118_RS06380 (OK118_06380) 1393216..1395009 - 1794 WP_228446142.1 phage tail tape measure protein -
OK118_RS06385 (OK118_06385) 1395062..1395226 - 165 WP_014607750.1 hypothetical protein -
OK118_RS06390 (OK118_06390) 1395253..1395675 - 423 WP_004085005.1 putative phage tail assembly chaperone -
OK118_RS06395 (OK118_06395) 1395672..1396109 - 438 WP_011097990.1 DUF3277 family protein -
OK118_RS06400 (OK118_06400) 1396119..1396352 - 234 WP_011097991.1 DUF3383 family protein -
OK118_RS06405 (OK118_06405) 1396369..1397247 - 879 WP_012382645.1 RNA-guided endonuclease TnpB family protein -
OK118_RS06410 (OK118_06410) 1397413..1397574 - 162 WP_014607806.1 helix-turn-helix domain-containing protein -
OK118_RS06415 (OK118_06415) 1397568..1398173 - 606 Protein_1246 IS607 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1386050..1404349 18299
- flank IS/Tn - - 1397568..1397789 221


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-87)

Antitoxin

Protein of unknown function DUF6290

(1-71)


Sequences

Toxin        


Download         Length: 89 a.a.        Molecular weight: 10163.79 Da        Isoelectric Point: 10.6086

>T262315 WP_011097988.1 NZ_CP109894:1392939-1393205 [Xylella fastidiosa subsp. fastidiosa]
MAWTIDYTDTAKQQLRKLDKHMARRIVDFMDERIAGLENPRSSGKALTGPLGGFWRYRVGDFRVVCAIQDSVLRVLVVRV
GHRGEIYR

Download         Length: 267 bp

Antitoxin


Download         Length: 76 a.a.        Molecular weight: 8615.63 Da        Isoelectric Point: 5.0958

>AT262315 WP_004091377.1 NZ_CP109894:1392728-1392955 [Xylella fastidiosa subsp. fastidiosa]
MATSIRLSPEMEQRLNSLASHTGRTKAYYLREIIEHGIEEMEDYYLAADVLERVRHGQEQVHSAADVRKTLGLDD

Download         Length: 228 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A060HDH1

Antitoxin

Source ID Structure
AlphaFold DB A0A7G7TPD2

References