Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pasABC/RelE-HTH |
| Location | 1392728..1393205 | Replicon | chromosome |
| Accession | NZ_CP109894 | ||
| Organism | Xylella fastidiosa subsp. fastidiosa strain CFBP8351 | ||
Toxin (Protein)
| Gene name | pasB | Uniprot ID | Q87CA4 |
| Locus tag | OK118_RS06375 | Protein ID | WP_011097988.1 |
| Coordinates | 1392939..1393205 (+) | Length | 89 a.a. |
Antitoxin (Protein)
| Gene name | pasA | Uniprot ID | A0A7G7TPD2 |
| Locus tag | OK118_RS06370 | Protein ID | WP_004091377.1 |
| Coordinates | 1392728..1392955 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OK118_RS06330 (OK118_06330) | 1387855..1389000 | - | 1146 | WP_011097984.1 | baseplate J/gp47 family protein | - |
| OK118_RS06335 (OK118_06335) | 1389099..1389395 | + | 297 | WP_004089252.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| OK118_RS06340 (OK118_06340) | 1389399..1389704 | + | 306 | WP_004089254.1 | putative addiction module antidote protein | - |
| OK118_RS06345 (OK118_06345) | 1389715..1390068 | - | 354 | WP_011097986.1 | hypothetical protein | - |
| OK118_RS06350 (OK118_06350) | 1390065..1390706 | - | 642 | WP_004090764.1 | Gp138 family membrane-puncturing spike protein | - |
| OK118_RS06355 (OK118_06355) | 1390703..1391533 | - | 831 | WP_004090766.1 | hypothetical protein | - |
| OK118_RS06360 (OK118_06360) | 1391530..1391847 | - | 318 | WP_011097873.1 | hypothetical protein | - |
| OK118_RS06365 (OK118_06365) | 1391847..1392617 | - | 771 | WP_004090769.1 | hypothetical protein | - |
| OK118_RS06370 (OK118_06370) | 1392728..1392955 | + | 228 | WP_004091377.1 | DUF6290 family protein | Antitoxin |
| OK118_RS06375 (OK118_06375) | 1392939..1393205 | + | 267 | WP_011097988.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OK118_RS06380 (OK118_06380) | 1393216..1395009 | - | 1794 | WP_228446142.1 | phage tail tape measure protein | - |
| OK118_RS06385 (OK118_06385) | 1395062..1395226 | - | 165 | WP_014607750.1 | hypothetical protein | - |
| OK118_RS06390 (OK118_06390) | 1395253..1395675 | - | 423 | WP_004085005.1 | putative phage tail assembly chaperone | - |
| OK118_RS06395 (OK118_06395) | 1395672..1396109 | - | 438 | WP_011097990.1 | DUF3277 family protein | - |
| OK118_RS06400 (OK118_06400) | 1396119..1396352 | - | 234 | WP_011097991.1 | DUF3383 family protein | - |
| OK118_RS06405 (OK118_06405) | 1396369..1397247 | - | 879 | WP_012382645.1 | RNA-guided endonuclease TnpB family protein | - |
| OK118_RS06410 (OK118_06410) | 1397413..1397574 | - | 162 | WP_014607806.1 | helix-turn-helix domain-containing protein | - |
| OK118_RS06415 (OK118_06415) | 1397568..1398173 | - | 606 | Protein_1246 | IS607 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1386050..1404349 | 18299 | |
| - | flank | IS/Tn | - | - | 1397568..1397789 | 221 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 89 a.a. Molecular weight: 10163.79 Da Isoelectric Point: 10.6086
>T262315 WP_011097988.1 NZ_CP109894:1392939-1393205 [Xylella fastidiosa subsp. fastidiosa]
MAWTIDYTDTAKQQLRKLDKHMARRIVDFMDERIAGLENPRSSGKALTGPLGGFWRYRVGDFRVVCAIQDSVLRVLVVRV
GHRGEIYR
MAWTIDYTDTAKQQLRKLDKHMARRIVDFMDERIAGLENPRSSGKALTGPLGGFWRYRVGDFRVVCAIQDSVLRVLVVRV
GHRGEIYR
Download Length: 267 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A060HDH1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7G7TPD2 |