Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumA-relB/COG3657-DUF971 |
| Location | 1389099..1389704 | Replicon | chromosome |
| Accession | NZ_CP109894 | ||
| Organism | Xylella fastidiosa subsp. fastidiosa strain CFBP8351 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | B2I5N3 |
| Locus tag | OK118_RS06335 | Protein ID | WP_004089252.1 |
| Coordinates | 1389099..1389395 (+) | Length | 99 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | OK118_RS06340 | Protein ID | WP_004089254.1 |
| Coordinates | 1389399..1389704 (+) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OK118_RS06310 (OK118_06310) | 1384264..1385241 | + | 978 | WP_004087353.1 | hypothetical protein | - |
| OK118_RS06315 (OK118_06315) | 1385500..1385946 | + | 447 | WP_004087355.1 | hypothetical protein | - |
| OK118_RS06320 (OK118_06320) | 1386050..1387294 | - | 1245 | WP_011097983.1 | tail fiber protein | - |
| OK118_RS06325 (OK118_06325) | 1387298..1387858 | - | 561 | WP_011097869.1 | DUF2612 domain-containing protein | - |
| OK118_RS06330 (OK118_06330) | 1387855..1389000 | - | 1146 | WP_011097984.1 | baseplate J/gp47 family protein | - |
| OK118_RS06335 (OK118_06335) | 1389099..1389395 | + | 297 | WP_004089252.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OK118_RS06340 (OK118_06340) | 1389399..1389704 | + | 306 | WP_004089254.1 | putative addiction module antidote protein | Antitoxin |
| OK118_RS06345 (OK118_06345) | 1389715..1390068 | - | 354 | WP_011097986.1 | hypothetical protein | - |
| OK118_RS06350 (OK118_06350) | 1390065..1390706 | - | 642 | WP_004090764.1 | Gp138 family membrane-puncturing spike protein | - |
| OK118_RS06355 (OK118_06355) | 1390703..1391533 | - | 831 | WP_004090766.1 | hypothetical protein | - |
| OK118_RS06360 (OK118_06360) | 1391530..1391847 | - | 318 | WP_011097873.1 | hypothetical protein | - |
| OK118_RS06365 (OK118_06365) | 1391847..1392617 | - | 771 | WP_004090769.1 | hypothetical protein | - |
| OK118_RS06370 (OK118_06370) | 1392728..1392955 | + | 228 | WP_004091377.1 | DUF6290 family protein | - |
| OK118_RS06375 (OK118_06375) | 1392939..1393205 | + | 267 | WP_011097988.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1386050..1404349 | 18299 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 10790.57 Da Isoelectric Point: 10.0509
>T262314 WP_004089252.1 NZ_CP109894:1389099-1389395 [Xylella fastidiosa subsp. fastidiosa]
MVELIKTSTFDAWINSLRDRKAAARIQARLDRLALGNPGDVKPVGAGISEMRIDHGPGYRIYFMKHGAVLILLLCGGDKS
SQVRDIEQAKALAALWKD
MVELIKTSTFDAWINSLRDRKAAARIQARLDRLALGNPGDVKPVGAGISEMRIDHGPGYRIYFMKHGAVLILLLCGGDKS
SQVRDIEQAKALAALWKD
Download Length: 297 bp
Antitoxin
Download Length: 102 a.a. Molecular weight: 10983.37 Da Isoelectric Point: 5.0941
>AT262314 WP_004089254.1 NZ_CP109894:1389399-1389704 [Xylella fastidiosa subsp. fastidiosa]
MNNETFSRYDTADYLKTEEDIAAYMEAVMEEGGRDNPAFIARALGAVARARNLSQLARDVGMSRQGLDKALSNDGNPSFS
TILKVAKALGLRMSFTPSSMS
MNNETFSRYDTADYLKTEEDIAAYMEAVMEEGGRDNPAFIARALGAVARARNLSQLARDVGMSRQGLDKALSNDGNPSFS
TILKVAKALGLRMSFTPSSMS
Download Length: 306 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|