Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relE-dinJ/YafQ-RelB |
Location | 1307814..1308345 | Replicon | chromosome |
Accession | NZ_CP109894 | ||
Organism | Xylella fastidiosa subsp. fastidiosa strain CFBP8351 |
Toxin (Protein)
Gene name | relE | Uniprot ID | Q87CH1 |
Locus tag | OK118_RS05900 | Protein ID | WP_004090909.1 |
Coordinates | 1308064..1308345 (+) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | dinJ | Uniprot ID | Q87CH2 |
Locus tag | OK118_RS05895 | Protein ID | WP_004090907.1 |
Coordinates | 1307814..1308077 (+) | Length | 88 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OK118_RS05870 (OK118_05870) | 1303040..1304218 | - | 1179 | WP_011097931.1 | phage tail sheath family protein | - |
OK118_RS05875 (OK118_05875) | 1304283..1305875 | - | 1593 | WP_012382617.1 | tail fiber domain-containing protein | - |
OK118_RS05880 (OK118_05880) | 1305883..1306440 | - | 558 | WP_011097610.1 | phage tail protein I | - |
OK118_RS05885 (OK118_05885) | 1306433..1307326 | - | 894 | WP_011097611.1 | baseplate J/gp47 family protein | - |
OK118_RS05890 (OK118_05890) | 1307326..1307688 | - | 363 | WP_014607615.1 | GPW/gp25 family protein | - |
OK118_RS05895 (OK118_05895) | 1307814..1308077 | + | 264 | WP_004090907.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
OK118_RS05900 (OK118_05900) | 1308064..1308345 | + | 282 | WP_004090909.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
OK118_RS05905 (OK118_05905) | 1308382..1308969 | - | 588 | WP_011097612.1 | phage baseplate assembly protein V | - |
OK118_RS05910 (OK118_05910) | 1308966..1309508 | - | 543 | WP_011097613.1 | hypothetical protein | - |
OK118_RS05915 (OK118_05915) | 1309484..1310005 | - | 522 | WP_011097614.1 | hypothetical protein | - |
OK118_RS05920 (OK118_05920) | 1310002..1310325 | - | 324 | WP_012382618.1 | hypothetical protein | - |
OK118_RS05925 (OK118_05925) | 1310325..1310585 | - | 261 | WP_012382619.1 | hypothetical protein | - |
OK118_RS05930 (OK118_05930) | 1310603..1312477 | - | 1875 | WP_012382620.1 | phage major capsid protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1294401..1341123 | 46722 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10936.37 Da Isoelectric Point: 7.2205
>T262313 WP_004090909.1 NZ_CP109894:1308064-1308345 [Xylella fastidiosa subsp. fastidiosa]
MRRISQTGQFKRDYKREAKGQHRATLDEELIHVLEALTCDHPLEPRHHDHALTGDWKDHRDCHIKPDLVLIYRKPDNETL
QLVRIGSHSELGL
MRRISQTGQFKRDYKREAKGQHRATLDEELIHVLEALTCDHPLEPRHHDHALTGDWKDHRDCHIKPDLVLIYRKPDNETL
QLVRIGSHSELGL
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|