Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | FicTA/Fic(toxin) |
| Location | 1216942..1217738 | Replicon | chromosome |
| Accession | NZ_CP109894 | ||
| Organism | Xylella fastidiosa subsp. fastidiosa strain CFBP8351 | ||
Toxin (Protein)
| Gene name | VbhT | Uniprot ID | Q87CQ8 |
| Locus tag | OK118_RS05390 | Protein ID | WP_004088112.1 |
| Coordinates | 1216942..1217553 (-) | Length | 204 a.a. |
Antitoxin (Protein)
| Gene name | VbhA | Uniprot ID | B2I551 |
| Locus tag | OK118_RS05395 | Protein ID | WP_004088114.1 |
| Coordinates | 1217550..1217738 (-) | Length | 63 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OK118_RS05345 (OK118_05345) | 1212397..1213284 | - | 888 | WP_012382597.1 | YdaU family protein | - |
| OK118_RS05350 (OK118_05350) | 1213281..1214069 | - | 789 | WP_011097897.1 | Bro-N domain-containing protein | - |
| OK118_RS05355 (OK118_05355) | 1214066..1214698 | - | 633 | WP_004088094.1 | Bro-N domain-containing protein | - |
| OK118_RS05360 (OK118_05360) | 1214695..1214958 | - | 264 | WP_228446177.1 | hypothetical protein | - |
| OK118_RS05365 (OK118_05365) | 1214976..1215191 | - | 216 | WP_012382598.1 | hypothetical protein | - |
| OK118_RS05370 (OK118_05370) | 1215221..1215409 | - | 189 | WP_004088102.1 | hypothetical protein | - |
| OK118_RS05375 (OK118_05375) | 1215437..1215628 | - | 192 | WP_004088104.1 | hypothetical protein | - |
| OK118_RS05380 (OK118_05380) | 1215887..1216132 | - | 246 | WP_004088108.1 | hypothetical protein | - |
| OK118_RS05385 (OK118_05385) | 1216217..1216891 | + | 675 | WP_012382600.1 | helix-turn-helix transcriptional regulator | - |
| OK118_RS05390 (OK118_05390) | 1216942..1217553 | - | 612 | WP_004088112.1 | Fic/DOC family protein | Toxin |
| OK118_RS05395 (OK118_05395) | 1217550..1217738 | - | 189 | WP_004088114.1 | antitoxin VbhA family protein | Antitoxin |
| OK118_RS05400 (OK118_05400) | 1218130..1218666 | + | 537 | WP_012382601.1 | hypothetical protein | - |
| OK118_RS05405 (OK118_05405) | 1218663..1219076 | + | 414 | WP_004088056.1 | DUF1566 domain-containing protein | - |
| OK118_RS05410 (OK118_05410) | 1219073..1219474 | + | 402 | WP_004088054.1 | hypothetical protein | - |
| OK118_RS05415 (OK118_05415) | 1219471..1219620 | + | 150 | WP_012382602.1 | hypothetical protein | - |
| OK118_RS05420 (OK118_05420) | 1219838..1219984 | + | 147 | WP_225621633.1 | hypothetical protein | - |
| OK118_RS05425 (OK118_05425) | 1220007..1220198 | + | 192 | WP_012382603.1 | hypothetical protein | - |
| OK118_RS05430 (OK118_05430) | 1220219..1220563 | + | 345 | WP_004088346.1 | hypothetical protein | - |
| OK118_RS05435 (OK118_05435) | 1220603..1221424 | + | 822 | WP_004088345.1 | DUF2303 family protein | - |
| OK118_RS05440 (OK118_05440) | 1221440..1222366 | + | 927 | WP_004088344.1 | phage recombination protein Bet | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1204039..1227488 | 23449 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 204 a.a. Molecular weight: 22832.60 Da Isoelectric Point: 5.1271
>T262312 WP_004088112.1 NZ_CP109894:c1217553-1216942 [Xylella fastidiosa subsp. fastidiosa]
MKYAGDRGDPYLDSETGVLRNLLGIRDQGGLDKIESTLSFLRTSELRERPVKGKFDLAHLQEIHNRLFQDVYDWAGQIRQ
VEISKGNTMFAQQIAIQSAAQQIFGQLAKERFLCGLDAEEFSKRAGDYLGEINVLHPFREGNGRTQREFIAQLAQRAGYR
IDWGVVSQADMIKASIDAYNGDSSGLASIIREGISDQLFKDNE
MKYAGDRGDPYLDSETGVLRNLLGIRDQGGLDKIESTLSFLRTSELRERPVKGKFDLAHLQEIHNRLFQDVYDWAGQIRQ
VEISKGNTMFAQQIAIQSAAQQIFGQLAKERFLCGLDAEEFSKRAGDYLGEINVLHPFREGNGRTQREFIAQLAQRAGYR
IDWGVVSQADMIKASIDAYNGDSSGLASIIREGISDQLFKDNE
Download Length: 612 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|