262312

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) FicTA/Fic(toxin)
Location 1216942..1217738 Replicon chromosome
Accession NZ_CP109894
Organism Xylella fastidiosa subsp. fastidiosa strain CFBP8351

Toxin (Protein)


Gene name VbhT Uniprot ID Q87CQ8
Locus tag OK118_RS05390 Protein ID WP_004088112.1
Coordinates 1216942..1217553 (-) Length 204 a.a.

Antitoxin (Protein)


Gene name VbhA Uniprot ID B2I551
Locus tag OK118_RS05395 Protein ID WP_004088114.1
Coordinates 1217550..1217738 (-) Length 63 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OK118_RS05345 (OK118_05345) 1212397..1213284 - 888 WP_012382597.1 YdaU family protein -
OK118_RS05350 (OK118_05350) 1213281..1214069 - 789 WP_011097897.1 Bro-N domain-containing protein -
OK118_RS05355 (OK118_05355) 1214066..1214698 - 633 WP_004088094.1 Bro-N domain-containing protein -
OK118_RS05360 (OK118_05360) 1214695..1214958 - 264 WP_228446177.1 hypothetical protein -
OK118_RS05365 (OK118_05365) 1214976..1215191 - 216 WP_012382598.1 hypothetical protein -
OK118_RS05370 (OK118_05370) 1215221..1215409 - 189 WP_004088102.1 hypothetical protein -
OK118_RS05375 (OK118_05375) 1215437..1215628 - 192 WP_004088104.1 hypothetical protein -
OK118_RS05380 (OK118_05380) 1215887..1216132 - 246 WP_004088108.1 hypothetical protein -
OK118_RS05385 (OK118_05385) 1216217..1216891 + 675 WP_012382600.1 helix-turn-helix transcriptional regulator -
OK118_RS05390 (OK118_05390) 1216942..1217553 - 612 WP_004088112.1 Fic/DOC family protein Toxin
OK118_RS05395 (OK118_05395) 1217550..1217738 - 189 WP_004088114.1 antitoxin VbhA family protein Antitoxin
OK118_RS05400 (OK118_05400) 1218130..1218666 + 537 WP_012382601.1 hypothetical protein -
OK118_RS05405 (OK118_05405) 1218663..1219076 + 414 WP_004088056.1 DUF1566 domain-containing protein -
OK118_RS05410 (OK118_05410) 1219073..1219474 + 402 WP_004088054.1 hypothetical protein -
OK118_RS05415 (OK118_05415) 1219471..1219620 + 150 WP_012382602.1 hypothetical protein -
OK118_RS05420 (OK118_05420) 1219838..1219984 + 147 WP_225621633.1 hypothetical protein -
OK118_RS05425 (OK118_05425) 1220007..1220198 + 192 WP_012382603.1 hypothetical protein -
OK118_RS05430 (OK118_05430) 1220219..1220563 + 345 WP_004088346.1 hypothetical protein -
OK118_RS05435 (OK118_05435) 1220603..1221424 + 822 WP_004088345.1 DUF2303 family protein -
OK118_RS05440 (OK118_05440) 1221440..1222366 + 927 WP_004088344.1 phage recombination protein Bet -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1204039..1227488 23449


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(55-152)

Antitoxin

Antitoxin VbhA

(10-56)


Sequences

Toxin        


Download         Length: 204 a.a.        Molecular weight: 22832.60 Da        Isoelectric Point: 5.1271

>T262312 WP_004088112.1 NZ_CP109894:c1217553-1216942 [Xylella fastidiosa subsp. fastidiosa]
MKYAGDRGDPYLDSETGVLRNLLGIRDQGGLDKIESTLSFLRTSELRERPVKGKFDLAHLQEIHNRLFQDVYDWAGQIRQ
VEISKGNTMFAQQIAIQSAAQQIFGQLAKERFLCGLDAEEFSKRAGDYLGEINVLHPFREGNGRTQREFIAQLAQRAGYR
IDWGVVSQADMIKASIDAYNGDSSGLASIIREGISDQLFKDNE

Download         Length: 612 bp

Antitoxin


Download         Length: 63 a.a.        Molecular weight: 6837.77 Da        Isoelectric Point: 4.9859

>AT262312 WP_004088114.1 NZ_CP109894:c1217738-1217550 [Xylella fastidiosa subsp. fastidiosa]
MLTDHEKAERRAVVQSALASQRIEGLEPDAQAVVDAECWARGEMTIAAAVDQYKARVRLQIA

Download         Length: 189 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q87CQ8

Antitoxin

Source ID Structure
AlphaFold DB B2I551

References