Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/-
Location 1554197..1554783 Replicon chromosome
Accession NZ_CP109891
Organism Xylella fastidiosa subsp. fastidiosa strain CFBP8083

Toxin (Protein)


Gene name hicA Uniprot ID Q87BV5
Locus tag OK113_RS07080 Protein ID WP_004089517.1
Coordinates 1554529..1554783 (-) Length 85 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID B2I6C9
Locus tag OK113_RS07075 Protein ID WP_004085025.1
Coordinates 1554197..1554532 (-) Length 112 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OK113_RS07045 (OK113_07045) 1549796..1550707 - 912 WP_004089529.1 iron-sulfur cluster carrier protein ApbC -
OK113_RS07050 (OK113_07050) 1551142..1551915 + 774 WP_004089528.1 3-deoxy-manno-octulosonate cytidylyltransferase -
OK113_RS07055 (OK113_07055) 1551912..1552376 + 465 WP_011098056.1 low molecular weight protein-tyrosine-phosphatase -
OK113_RS07060 (OK113_07060) 1552363..1553076 - 714 WP_011098057.1 site-specific DNA-methyltransferase -
OK113_RS07065 (OK113_07065) 1553427..1553708 + 282 WP_011098058.1 type II toxin-antitoxin system RelE/ParE family toxin -
OK113_RS07070 (OK113_07070) 1553718..1554017 + 300 WP_004089519.1 HigA family addiction module antitoxin -
OK113_RS07075 (OK113_07075) 1554197..1554532 - 336 WP_004085025.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
OK113_RS07080 (OK113_07080) 1554529..1554783 - 255 WP_004089517.1 type II toxin-antitoxin system HicA family toxin Toxin
OK113_RS07085 (OK113_07085) 1554836..1555534 - 699 WP_011098059.1 hypothetical protein -
OK113_RS07090 (OK113_07090) 1555663..1556124 - 462 WP_011098060.1 hypothetical protein -
OK113_RS07095 (OK113_07095) 1556121..1556810 - 690 WP_011098061.1 hypothetical protein -
OK113_RS07100 (OK113_07100) 1556791..1557890 - 1100 Protein_1381 YdaU family protein -
OK113_RS07105 (OK113_07105) 1557887..1558132 - 246 WP_225621698.1 hypothetical protein -
OK113_RS07110 (OK113_07110) 1558288..1558662 + 375 WP_004091110.1 conjugal transfer protein -
OK113_RS07115 (OK113_07115) 1558668..1559273 + 606 WP_004091108.1 conjugal transfer protein TrbN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1527285..1574046 46761


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(23-80)

Antitoxin

Uncharacterised protein family HicB

(55-105)


Sequences

Toxin        


Download         Length: 85 a.a.        Molecular weight: 9639.14 Da        Isoelectric Point: 11.2766

>T262307 WP_004089517.1 NZ_CP109891:c1554783-1554529 [Xylella fastidiosa subsp. fastidiosa]
MKRKHAKTLSAIYTRPVSANIQWRDIEALFVELGAKVEEREGSRMLVRLFGERRIFHRPHPSPNTDKGAVESIRAWLKSN
GVTP

Download         Length: 255 bp

Antitoxin


Download         Length: 112 a.a.        Molecular weight: 12324.07 Da        Isoelectric Point: 5.6556

>AT262307 WP_004085025.1 NZ_CP109891:c1554532-1554197 [Xylella fastidiosa subsp. fastidiosa]
MKNIMTIESFKAIITYDPEIDMFRGEFVGINGGADFYAKDLKGLRREGAISLKVFLEACKEDSVEPRKCYSGKFNARISP
ELHALASEAAAAQGISLNQFVEQAIQHEVHT

Download         Length: 336 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q87BV5

Antitoxin

Source ID Structure
AlphaFold DB A0A060HAK5

References