Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relE-dinJ/YafQ-RelB
Location 1276143..1276674 Replicon chromosome
Accession NZ_CP109891
Organism Xylella fastidiosa subsp. fastidiosa strain CFBP8083

Toxin (Protein)


Gene name relE Uniprot ID Q87CH1
Locus tag OK113_RS05700 Protein ID WP_004090909.1
Coordinates 1276393..1276674 (+) Length 94 a.a.

Antitoxin (Protein)


Gene name dinJ Uniprot ID Q87CH2
Locus tag OK113_RS05695 Protein ID WP_004090907.1
Coordinates 1276143..1276406 (+) Length 88 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OK113_RS05670 (OK113_05670) 1271369..1272547 - 1179 WP_011097931.1 phage tail sheath family protein -
OK113_RS05675 (OK113_05675) 1272612..1274204 - 1593 WP_012382617.1 tail fiber domain-containing protein -
OK113_RS05680 (OK113_05680) 1274212..1274769 - 558 WP_011097610.1 phage tail protein I -
OK113_RS05685 (OK113_05685) 1274762..1275655 - 894 WP_011097611.1 baseplate J/gp47 family protein -
OK113_RS05690 (OK113_05690) 1275655..1276017 - 363 WP_014607615.1 GPW/gp25 family protein -
OK113_RS05695 (OK113_05695) 1276143..1276406 + 264 WP_004090907.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
OK113_RS05700 (OK113_05700) 1276393..1276674 + 282 WP_004090909.1 type II toxin-antitoxin system YafQ family toxin Toxin
OK113_RS05705 (OK113_05705) 1276711..1277298 - 588 WP_004090703.1 phage baseplate assembly protein V -
OK113_RS05710 (OK113_05710) 1277295..1277837 - 543 WP_011097613.1 hypothetical protein -
OK113_RS05715 (OK113_05715) 1277813..1278334 - 522 WP_011097614.1 hypothetical protein -
OK113_RS05720 (OK113_05720) 1278331..1278654 - 324 WP_011097935.1 hypothetical protein -
OK113_RS05725 (OK113_05725) 1278654..1278914 - 261 WP_038232801.1 hypothetical protein -
OK113_RS05730 (OK113_05730) 1278932..1280806 - 1875 WP_038232803.1 phage major capsid protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1262730..1309541 46811


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-91)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(4-70)


Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 10936.37 Da        Isoelectric Point: 7.2205

>T262306 WP_004090909.1 NZ_CP109891:1276393-1276674 [Xylella fastidiosa subsp. fastidiosa]
MRRISQTGQFKRDYKREAKGQHRATLDEELIHVLEALTCDHPLEPRHHDHALTGDWKDHRDCHIKPDLVLIYRKPDNETL
QLVRIGSHSELGL

Download         Length: 282 bp

Antitoxin


Download         Length: 88 a.a.        Molecular weight: 9495.95 Da        Isoelectric Point: 5.6033

>AT262306 WP_004090907.1 NZ_CP109891:1276143-1276406 [Xylella fastidiosa subsp. fastidiosa]
MSANAVVRARVDAHIKEEASTVLATMGLSVSDAFRMMLTRIAREKALPFEPLVPNETTIAAMREARAGHLKSFDSIEALM
ADLHAED

Download         Length: 264 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q87CH1

Antitoxin

Source ID Structure
AlphaFold DB Q87CH2

References