262305

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) FicTA/Fic(toxin)
Location 1185217..1186013 Replicon chromosome
Accession NZ_CP109891
Organism Xylella fastidiosa subsp. fastidiosa strain CFBP8083

Toxin (Protein)


Gene name VbhT Uniprot ID Q87CQ8
Locus tag OK113_RS05190 Protein ID WP_004088112.1
Coordinates 1185217..1185828 (-) Length 204 a.a.

Antitoxin (Protein)


Gene name VbhA Uniprot ID B2I551
Locus tag OK113_RS05195 Protein ID WP_004088114.1
Coordinates 1185825..1186013 (-) Length 63 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OK113_RS05145 (OK113_05145) 1180672..1181559 - 888 WP_012382597.1 YdaU family protein -
OK113_RS05150 (OK113_05150) 1181556..1182344 - 789 WP_011097897.1 Bro-N domain-containing protein -
OK113_RS05155 (OK113_05155) 1182341..1182973 - 633 WP_004088094.1 Bro-N domain-containing protein -
OK113_RS05160 (OK113_05160) 1182970..1183233 - 264 WP_228446177.1 hypothetical protein -
OK113_RS05165 (OK113_05165) 1183251..1183466 - 216 WP_012382598.1 hypothetical protein -
OK113_RS05170 (OK113_05170) 1183496..1183684 - 189 WP_004088102.1 hypothetical protein -
OK113_RS05175 (OK113_05175) 1183712..1183903 - 192 WP_004088104.1 hypothetical protein -
OK113_RS05180 (OK113_05180) 1184162..1184407 - 246 WP_004088108.1 hypothetical protein -
OK113_RS05185 (OK113_05185) 1184492..1185166 + 675 WP_004088110.1 helix-turn-helix transcriptional regulator -
OK113_RS05190 (OK113_05190) 1185217..1185828 - 612 WP_004088112.1 Fic/DOC family protein Toxin
OK113_RS05195 (OK113_05195) 1185825..1186013 - 189 WP_004088114.1 antitoxin VbhA family protein Antitoxin
OK113_RS05200 (OK113_05200) 1186405..1186941 + 537 WP_038233020.1 hypothetical protein -
OK113_RS05205 (OK113_05205) 1186938..1187351 + 414 WP_004088056.1 DUF1566 domain-containing protein -
OK113_RS05210 (OK113_05210) 1187348..1187749 + 402 WP_004088054.1 hypothetical protein -
OK113_RS05215 (OK113_05215) 1187746..1187895 + 150 WP_012382602.1 hypothetical protein -
OK113_RS05220 (OK113_05220) 1188113..1188259 + 147 WP_225621633.1 hypothetical protein -
OK113_RS05225 (OK113_05225) 1188282..1188473 + 192 WP_012382603.1 hypothetical protein -
OK113_RS05230 (OK113_05230) 1188494..1188838 + 345 WP_004088346.1 hypothetical protein -
OK113_RS05235 (OK113_05235) 1188878..1189699 + 822 WP_004088345.1 DUF2303 family protein -
OK113_RS05240 (OK113_05240) 1189715..1190641 + 927 WP_004088344.1 phage recombination protein Bet -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1155053..1195763 40710


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(55-152)

Antitoxin

Antitoxin VbhA

(10-56)


Sequences

Toxin        


Download         Length: 204 a.a.        Molecular weight: 22832.60 Da        Isoelectric Point: 5.1271

>T262305 WP_004088112.1 NZ_CP109891:c1185828-1185217 [Xylella fastidiosa subsp. fastidiosa]
MKYAGDRGDPYLDSETGVLRNLLGIRDQGGLDKIESTLSFLRTSELRERPVKGKFDLAHLQEIHNRLFQDVYDWAGQIRQ
VEISKGNTMFAQQIAIQSAAQQIFGQLAKERFLCGLDAEEFSKRAGDYLGEINVLHPFREGNGRTQREFIAQLAQRAGYR
IDWGVVSQADMIKASIDAYNGDSSGLASIIREGISDQLFKDNE

Download         Length: 612 bp

Antitoxin


Download         Length: 63 a.a.        Molecular weight: 6837.77 Da        Isoelectric Point: 4.9859

>AT262305 WP_004088114.1 NZ_CP109891:c1186013-1185825 [Xylella fastidiosa subsp. fastidiosa]
MLTDHEKAERRAVVQSALASQRIEGLEPDAQAVVDAECWARGEMTIAAAVDQYKARVRLQIA

Download         Length: 189 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q87CQ8

Antitoxin

Source ID Structure
AlphaFold DB B2I551

References