Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pasABC/RelE-HTH |
| Location | 1161640..1162117 | Replicon | chromosome |
| Accession | NZ_CP109891 | ||
| Organism | Xylella fastidiosa subsp. fastidiosa strain CFBP8083 | ||
Toxin (Protein)
| Gene name | pasB | Uniprot ID | Q87CA4 |
| Locus tag | OK113_RS05000 | Protein ID | WP_011097988.1 |
| Coordinates | 1161851..1162117 (+) | Length | 89 a.a. |
Antitoxin (Protein)
| Gene name | pasA | Uniprot ID | A0A7G7TPD2 |
| Locus tag | OK113_RS04995 | Protein ID | WP_004091377.1 |
| Coordinates | 1161640..1161867 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OK113_RS04950 (OK113_04950) | 1156777..1156977 | - | 201 | WP_236641891.1 | hypothetical protein | - |
| OK113_RS04955 (OK113_04955) | 1157028..1157912 | - | 885 | WP_236641892.1 | baseplate J/gp47 family protein | - |
| OK113_RS04960 (OK113_04960) | 1158011..1158307 | + | 297 | WP_004089252.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| OK113_RS04965 (OK113_04965) | 1158311..1158616 | + | 306 | WP_004089254.1 | putative addiction module antidote protein | - |
| OK113_RS04970 (OK113_04970) | 1158627..1158980 | - | 354 | WP_011097986.1 | hypothetical protein | - |
| OK113_RS04975 (OK113_04975) | 1158977..1159618 | - | 642 | WP_004090764.1 | Gp138 family membrane-puncturing spike protein | - |
| OK113_RS04980 (OK113_04980) | 1159615..1160445 | - | 831 | WP_004090766.1 | hypothetical protein | - |
| OK113_RS04985 (OK113_04985) | 1160442..1160759 | - | 318 | WP_011097873.1 | hypothetical protein | - |
| OK113_RS04990 (OK113_04990) | 1160759..1161529 | - | 771 | WP_004090769.1 | hypothetical protein | - |
| OK113_RS04995 (OK113_04995) | 1161640..1161867 | + | 228 | WP_004091377.1 | DUF6290 family protein | Antitoxin |
| OK113_RS05000 (OK113_05000) | 1161851..1162117 | + | 267 | WP_011097988.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OK113_RS05005 (OK113_05005) | 1162128..1163915 | - | 1788 | WP_243857829.1 | phage tail tape measure protein | - |
| OK113_RS05010 (OK113_05010) | 1163974..1164138 | - | 165 | WP_162849007.1 | hypothetical protein | - |
| OK113_RS05015 (OK113_05015) | 1164165..1164587 | - | 423 | WP_012382587.1 | putative phage tail assembly chaperone | - |
| OK113_RS05020 (OK113_05020) | 1164584..1165021 | - | 438 | WP_011097990.1 | DUF3277 family protein | - |
| OK113_RS05025 (OK113_05025) | 1165031..1166527 | - | 1497 | WP_038232978.1 | DUF3383 domain-containing protein | - |
| OK113_RS05030 (OK113_05030) | 1166528..1167061 | - | 534 | WP_004090297.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1155053..1195763 | 40710 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 89 a.a. Molecular weight: 10163.79 Da Isoelectric Point: 10.6086
>T262304 WP_011097988.1 NZ_CP109891:1161851-1162117 [Xylella fastidiosa subsp. fastidiosa]
MAWTIDYTDTAKQQLRKLDKHMARRIVDFMDERIAGLENPRSSGKALTGPLGGFWRYRVGDFRVVCAIQDSVLRVLVVRV
GHRGEIYR
MAWTIDYTDTAKQQLRKLDKHMARRIVDFMDERIAGLENPRSSGKALTGPLGGFWRYRVGDFRVVCAIQDSVLRVLVVRV
GHRGEIYR
Download Length: 267 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A060HDH1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7G7TPD2 |