Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) pasABC/RelE-HTH
Location 1161640..1162117 Replicon chromosome
Accession NZ_CP109891
Organism Xylella fastidiosa subsp. fastidiosa strain CFBP8083

Toxin (Protein)


Gene name pasB Uniprot ID Q87CA4
Locus tag OK113_RS05000 Protein ID WP_011097988.1
Coordinates 1161851..1162117 (+) Length 89 a.a.

Antitoxin (Protein)


Gene name pasA Uniprot ID A0A7G7TPD2
Locus tag OK113_RS04995 Protein ID WP_004091377.1
Coordinates 1161640..1161867 (+) Length 76 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OK113_RS04950 (OK113_04950) 1156777..1156977 - 201 WP_236641891.1 hypothetical protein -
OK113_RS04955 (OK113_04955) 1157028..1157912 - 885 WP_236641892.1 baseplate J/gp47 family protein -
OK113_RS04960 (OK113_04960) 1158011..1158307 + 297 WP_004089252.1 type II toxin-antitoxin system RelE/ParE family toxin -
OK113_RS04965 (OK113_04965) 1158311..1158616 + 306 WP_004089254.1 putative addiction module antidote protein -
OK113_RS04970 (OK113_04970) 1158627..1158980 - 354 WP_011097986.1 hypothetical protein -
OK113_RS04975 (OK113_04975) 1158977..1159618 - 642 WP_004090764.1 Gp138 family membrane-puncturing spike protein -
OK113_RS04980 (OK113_04980) 1159615..1160445 - 831 WP_004090766.1 hypothetical protein -
OK113_RS04985 (OK113_04985) 1160442..1160759 - 318 WP_011097873.1 hypothetical protein -
OK113_RS04990 (OK113_04990) 1160759..1161529 - 771 WP_004090769.1 hypothetical protein -
OK113_RS04995 (OK113_04995) 1161640..1161867 + 228 WP_004091377.1 DUF6290 family protein Antitoxin
OK113_RS05000 (OK113_05000) 1161851..1162117 + 267 WP_011097988.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
OK113_RS05005 (OK113_05005) 1162128..1163915 - 1788 WP_243857829.1 phage tail tape measure protein -
OK113_RS05010 (OK113_05010) 1163974..1164138 - 165 WP_162849007.1 hypothetical protein -
OK113_RS05015 (OK113_05015) 1164165..1164587 - 423 WP_012382587.1 putative phage tail assembly chaperone -
OK113_RS05020 (OK113_05020) 1164584..1165021 - 438 WP_011097990.1 DUF3277 family protein -
OK113_RS05025 (OK113_05025) 1165031..1166527 - 1497 WP_038232978.1 DUF3383 domain-containing protein -
OK113_RS05030 (OK113_05030) 1166528..1167061 - 534 WP_004090297.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1155053..1195763 40710


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-87)

Antitoxin

Protein of unknown function DUF6290

(1-71)


Sequences

Toxin        


Download         Length: 89 a.a.        Molecular weight: 10163.79 Da        Isoelectric Point: 10.6086

>T262304 WP_011097988.1 NZ_CP109891:1161851-1162117 [Xylella fastidiosa subsp. fastidiosa]
MAWTIDYTDTAKQQLRKLDKHMARRIVDFMDERIAGLENPRSSGKALTGPLGGFWRYRVGDFRVVCAIQDSVLRVLVVRV
GHRGEIYR

Download         Length: 267 bp

Antitoxin


Download         Length: 76 a.a.        Molecular weight: 8615.63 Da        Isoelectric Point: 5.0958

>AT262304 WP_004091377.1 NZ_CP109891:1161640-1161867 [Xylella fastidiosa subsp. fastidiosa]
MATSIRLSPEMEQRLNSLASHTGRTKAYYLREIIEHGIEEMEDYYLAADVLERVRHGQEQVHSAADVRKTLGLDD

Download         Length: 228 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A060HDH1

Antitoxin

Source ID Structure
AlphaFold DB A0A7G7TPD2

References