Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mqsR-graA/MqsR-HigA
Location 457368..458033 Replicon chromosome
Accession NZ_CP109891
Organism Xylella fastidiosa subsp. fastidiosa strain CFBP8083

Toxin (Protein)


Gene name mqsR Uniprot ID Q87EE2
Locus tag OK113_RS01900 Protein ID WP_004090696.1
Coordinates 457731..458033 (+) Length 101 a.a.

Antitoxin (Protein)


Gene name graA Uniprot ID -
Locus tag OK113_RS01895 Protein ID WP_004085172.1
Coordinates 457368..457643 (+) Length 92 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OK113_RS01865 (OK113_01865) 453499..454188 - 690 WP_012382453.1 contractile injection system protein, VgrG/Pvc8 family -
OK113_RS01870 (OK113_01870) 454118..455089 - 972 WP_159241593.1 hypothetical protein -
OK113_RS01875 (OK113_01875) 455097..455654 - 558 WP_011097610.1 phage tail protein I -
OK113_RS01880 (OK113_01880) 455647..456540 - 894 WP_011097611.1 baseplate J/gp47 family protein -
OK113_RS01885 (OK113_01885) 456540..456902 - 363 WP_014607615.1 GPW/gp25 family protein -
OK113_RS01890 (OK113_01890) 457076..457357 + 282 WP_004090695.1 type II toxin-antitoxin system RelE/ParE family toxin -
OK113_RS01895 (OK113_01895) 457368..457643 + 276 WP_004085172.1 HigA family addiction module antitoxin Antitoxin
OK113_RS01900 (OK113_01900) 457731..458033 + 303 WP_004090696.1 type II toxin-antitoxin system MqsR family toxin Toxin
OK113_RS01905 (OK113_01905) 458036..458437 + 402 WP_004090697.1 type II toxin-antitoxin system MqsA family antitoxin -
OK113_RS01910 (OK113_01910) 458506..459093 - 588 WP_004090703.1 phage baseplate assembly protein V -
OK113_RS01915 (OK113_01915) 459090..459632 - 543 WP_011097613.1 hypothetical protein -
OK113_RS01920 (OK113_01920) 459608..460129 - 522 WP_057683415.1 hypothetical protein -
OK113_RS01925 (OK113_01925) 460126..460449 - 324 WP_038233035.1 hypothetical protein -
OK113_RS01930 (OK113_01930) 460449..460709 - 261 WP_011097616.1 hypothetical protein -
OK113_RS01935 (OK113_01935) 460727..462601 - 1875 WP_140161485.1 phage major capsid protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 445674..469587 23913


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin MqsR

(2-99)

Antitoxin

Cro/C1-type helix-turn-helix domain

(15-64)


Sequences

Toxin        


Download         Length: 101 a.a.        Molecular weight: 10948.71 Da        Isoelectric Point: 8.0251

>T262301 WP_004090696.1 NZ_CP109891:457731-458033 [Xylella fastidiosa subsp. fastidiosa]
MEKGTSHYKLPVVKALVKAGKVRATATAYQGARELGIKDLTGMCTVVLALTSADFYKSMTTYADHTVFQDVYHAKTASGD
EVYLKLTVIDDVLIVSFKEL

Download         Length: 303 bp

Antitoxin


Download         Length: 92 a.a.        Molecular weight: 10072.68 Da        Isoelectric Point: 10.2184

>AT262301 WP_004085172.1 NZ_CP109891:457368-457643 [Xylella fastidiosa subsp. fastidiosa]
MKRMHNPAHPGEVLREYLGELTVTNAAAKLGVSRVALSRILNGTNGISADMALRLEDALGTSAEMWAAMQFKYDLWVASQ
QPRPKITRLHV

Download         Length: 276 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q87EE2

Antitoxin

Source ID Structure

References