Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/upstrm_HI1419-dnstrm_HI1420 |
Location | 2486512..2487123 | Replicon | chromosome |
Accession | NZ_CP109890 | ||
Organism | Xylella fastidiosa subsp. fastidiosa strain WM1-1 |
Toxin (Protein)
Gene name | relE | Uniprot ID | Q879T9 |
Locus tag | OK119_RS11160 | Protein ID | WP_011098375.1 |
Coordinates | 2486824..2487123 (-) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | Q879U0 |
Locus tag | OK119_RS11155 | Protein ID | WP_004085003.1 |
Coordinates | 2486512..2486820 (-) | Length | 103 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OK119_RS11125 (OK119_11120) | 2483082..2483843 | - | 762 | WP_004090267.1 | Bax inhibitor-1/YccA family protein | - |
OK119_RS11150 (OK119_11145) | 2485035..2486438 | + | 1404 | WP_011098374.1 | hypothetical protein | - |
OK119_RS11155 (OK119_11150) | 2486512..2486820 | - | 309 | WP_004085003.1 | putative addiction module antidote protein | Antitoxin |
OK119_RS11160 (OK119_11155) | 2486824..2487123 | - | 300 | WP_011098375.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OK119_RS11165 (OK119_11160) | 2487211..2487744 | + | 534 | WP_225621759.1 | hypothetical protein | - |
OK119_RS11170 (OK119_11165) | 2487767..2487910 | + | 144 | WP_155115087.1 | hypothetical protein | - |
OK119_RS11175 (OK119_11170) | 2488063..2488443 | - | 381 | WP_004089371.1 | DUF596 domain-containing protein | - |
OK119_RS11180 (OK119_11175) | 2488448..2489578 | - | 1131 | WP_012382788.1 | DUF769 domain-containing protein | - |
OK119_RS11185 (OK119_11180) | 2489886..2490266 | - | 381 | WP_004087391.1 | DUF596 domain-containing protein | - |
OK119_RS11190 (OK119_11185) | 2490278..2491639 | - | 1362 | WP_012382789.1 | DUF637 domain-containing protein | - |
OK119_RS11195 (OK119_11190) | 2491719..2491862 | + | 144 | WP_155115088.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 2437272..2487573 | 50301 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11378.17 Da Isoelectric Point: 10.3861
>T262299 WP_011098375.1 NZ_CP109890:c2487123-2486824 [Xylella fastidiosa subsp. fastidiosa]
MTYTLKRLEGFSDWLKGLKDGLARQRLIKRLRKVQLGNFGDVQPVGEGVFEMREHFGPGWRMYYVQRGSFLIVMLGGGDK
STQQSDIRRAIELAKSLED
MTYTLKRLEGFSDWLKGLKDGLARQRLIKRLRKVQLGNFGDVQPVGEGVFEMREHFGPGWRMYYVQRGSFLIVMLGGGDK
STQQSDIRRAIELAKSLED
Download Length: 300 bp
Antitoxin
Download Length: 103 a.a. Molecular weight: 11060.61 Da Isoelectric Point: 4.6535
>AT262299 WP_004085003.1 NZ_CP109890:c2486820-2486512 [Xylella fastidiosa subsp. fastidiosa]
VTITKKINVSELPEFDAAEYLNSEEEVAAYLTAVLEENDPALLAAALGDIARSRGMSQIAKDSGITREALYKALRPGSEP
RFDTISRVCTALGIRLVAQPMH
VTITKKINVSELPEFDAAEYLNSEEEVAAYLTAVLEENDPALLAAALGDIARSRGMSQIAKDSGITREALYKALRPGSEP
RFDTISRVCTALGIRLVAQPMH
Download Length: 309 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q879T9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A060HCD4 |