Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/-
Location 1553130..1553716 Replicon chromosome
Accession NZ_CP109890
Organism Xylella fastidiosa subsp. fastidiosa strain WM1-1

Toxin (Protein)


Gene name hicA Uniprot ID Q87BV5
Locus tag OK119_RS07090 Protein ID WP_004089517.1
Coordinates 1553462..1553716 (-) Length 85 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID B2I6C9
Locus tag OK119_RS07085 Protein ID WP_004085025.1
Coordinates 1553130..1553465 (-) Length 112 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OK119_RS07055 (OK119_07055) 1548729..1549640 - 912 WP_004089529.1 iron-sulfur cluster carrier protein ApbC -
OK119_RS07060 (OK119_07060) 1550075..1550848 + 774 WP_004089528.1 3-deoxy-manno-octulosonate cytidylyltransferase -
OK119_RS07065 (OK119_07065) 1550845..1551309 + 465 WP_011098056.1 low molecular weight protein-tyrosine-phosphatase -
OK119_RS07070 (OK119_07070) 1551296..1552009 - 714 WP_011098057.1 site-specific DNA-methyltransferase -
OK119_RS07075 (OK119_07075) 1552360..1552641 + 282 WP_011098058.1 type II toxin-antitoxin system RelE/ParE family toxin -
OK119_RS07080 (OK119_07080) 1552651..1552950 + 300 WP_004089519.1 HigA family addiction module antitoxin -
OK119_RS07085 (OK119_07085) 1553130..1553465 - 336 WP_004085025.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
OK119_RS07090 (OK119_07090) 1553462..1553716 - 255 WP_004089517.1 type II toxin-antitoxin system HicA family toxin Toxin
OK119_RS07095 (OK119_07095) 1553769..1554467 - 699 WP_011098059.1 hypothetical protein -
OK119_RS07100 (OK119_07100) 1554596..1555057 - 462 WP_011098060.1 hypothetical protein -
OK119_RS07105 (OK119_07105) 1555054..1555743 - 690 WP_011098061.1 hypothetical protein -
OK119_RS07110 (OK119_07110) 1555724..1556821 - 1098 WP_004090691.1 YdaU family protein -
OK119_RS07115 (OK119_07115) 1556818..1557063 - 246 WP_225621698.1 hypothetical protein -
OK119_RS07120 (OK119_07120) 1557219..1557593 + 375 WP_004091110.1 conjugal transfer protein -
OK119_RS07125 (OK119_07125) 1557599..1558204 + 606 WP_004091108.1 conjugal transfer protein TrbN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(23-80)

Antitoxin

Uncharacterised protein family HicB

(55-105)


Sequences

Toxin        


Download         Length: 85 a.a.        Molecular weight: 9639.14 Da        Isoelectric Point: 11.2766

>T262298 WP_004089517.1 NZ_CP109890:c1553716-1553462 [Xylella fastidiosa subsp. fastidiosa]
MKRKHAKTLSAIYTRPVSANIQWRDIEALFVELGAKVEEREGSRMLVRLFGERRIFHRPHPSPNTDKGAVESIRAWLKSN
GVTP

Download         Length: 255 bp

Antitoxin


Download         Length: 112 a.a.        Molecular weight: 12324.07 Da        Isoelectric Point: 5.6556

>AT262298 WP_004085025.1 NZ_CP109890:c1553465-1553130 [Xylella fastidiosa subsp. fastidiosa]
MKNIMTIESFKAIITYDPEIDMFRGEFVGINGGADFYAKDLKGLRREGAISLKVFLEACKEDSVEPRKCYSGKFNARISP
ELHALASEAAAAQGISLNQFVEQAIQHEVHT

Download         Length: 336 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q87BV5

Antitoxin

Source ID Structure
AlphaFold DB A0A060HAK5

References