Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relE-dinJ/YafQ-RelB
Location 1275648..1276179 Replicon chromosome
Accession NZ_CP109890
Organism Xylella fastidiosa subsp. fastidiosa strain WM1-1

Toxin (Protein)


Gene name relE Uniprot ID Q87CH1
Locus tag OK119_RS05720 Protein ID WP_004090909.1
Coordinates 1275898..1276179 (+) Length 94 a.a.

Antitoxin (Protein)


Gene name dinJ Uniprot ID Q87CH2
Locus tag OK119_RS05715 Protein ID WP_004090907.1
Coordinates 1275648..1275911 (+) Length 88 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OK119_RS05690 (OK119_05690) 1270874..1272052 - 1179 WP_128734780.1 phage tail sheath family protein -
OK119_RS05695 (OK119_05695) 1272117..1273709 - 1593 WP_159241645.1 hypothetical protein -
OK119_RS05700 (OK119_05700) 1273717..1274274 - 558 WP_004086970.1 phage tail protein I -
OK119_RS05705 (OK119_05705) 1274267..1275160 - 894 WP_011097611.1 baseplate J/gp47 family protein -
OK119_RS05710 (OK119_05710) 1275160..1275522 - 363 WP_014607615.1 GPW/gp25 family protein -
OK119_RS05715 (OK119_05715) 1275648..1275911 + 264 WP_004090907.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
OK119_RS05720 (OK119_05720) 1275898..1276179 + 282 WP_004090909.1 type II toxin-antitoxin system YafQ family toxin Toxin
OK119_RS05725 (OK119_05725) 1276216..1276803 - 588 WP_011097612.1 phage baseplate assembly protein V -
OK119_RS05730 (OK119_05730) 1276800..1277342 - 543 WP_011097613.1 hypothetical protein -
OK119_RS05735 (OK119_05735) 1277318..1277839 - 522 WP_011097614.1 hypothetical protein -
OK119_RS05740 (OK119_05740) 1277836..1278159 - 324 WP_011097935.1 hypothetical protein -
OK119_RS05745 (OK119_05745) 1278159..1278419 - 261 WP_038232801.1 hypothetical protein -
OK119_RS05750 (OK119_05750) 1278437..1280311 - 1875 WP_140161278.1 phage major capsid protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1262235..1308442 46207


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-91)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(4-70)


Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 10936.37 Da        Isoelectric Point: 7.2205

>T262297 WP_004090909.1 NZ_CP109890:1275898-1276179 [Xylella fastidiosa subsp. fastidiosa]
MRRISQTGQFKRDYKREAKGQHRATLDEELIHVLEALTCDHPLEPRHHDHALTGDWKDHRDCHIKPDLVLIYRKPDNETL
QLVRIGSHSELGL

Download         Length: 282 bp

Antitoxin


Download         Length: 88 a.a.        Molecular weight: 9495.95 Da        Isoelectric Point: 5.6033

>AT262297 WP_004090907.1 NZ_CP109890:1275648-1275911 [Xylella fastidiosa subsp. fastidiosa]
MSANAVVRARVDAHIKEEASTVLATMGLSVSDAFRMMLTRIAREKALPFEPLVPNETTIAAMREARAGHLKSFDSIEALM
ADLHAED

Download         Length: 264 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q87CH1

Antitoxin

Source ID Structure
AlphaFold DB Q87CH2

References