Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relE-dinJ/YafQ-RelB |
| Location | 1275648..1276179 | Replicon | chromosome |
| Accession | NZ_CP109890 | ||
| Organism | Xylella fastidiosa subsp. fastidiosa strain WM1-1 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | Q87CH1 |
| Locus tag | OK119_RS05720 | Protein ID | WP_004090909.1 |
| Coordinates | 1275898..1276179 (+) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | dinJ | Uniprot ID | Q87CH2 |
| Locus tag | OK119_RS05715 | Protein ID | WP_004090907.1 |
| Coordinates | 1275648..1275911 (+) | Length | 88 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OK119_RS05690 (OK119_05690) | 1270874..1272052 | - | 1179 | WP_128734780.1 | phage tail sheath family protein | - |
| OK119_RS05695 (OK119_05695) | 1272117..1273709 | - | 1593 | WP_159241645.1 | hypothetical protein | - |
| OK119_RS05700 (OK119_05700) | 1273717..1274274 | - | 558 | WP_004086970.1 | phage tail protein I | - |
| OK119_RS05705 (OK119_05705) | 1274267..1275160 | - | 894 | WP_011097611.1 | baseplate J/gp47 family protein | - |
| OK119_RS05710 (OK119_05710) | 1275160..1275522 | - | 363 | WP_014607615.1 | GPW/gp25 family protein | - |
| OK119_RS05715 (OK119_05715) | 1275648..1275911 | + | 264 | WP_004090907.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| OK119_RS05720 (OK119_05720) | 1275898..1276179 | + | 282 | WP_004090909.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
| OK119_RS05725 (OK119_05725) | 1276216..1276803 | - | 588 | WP_011097612.1 | phage baseplate assembly protein V | - |
| OK119_RS05730 (OK119_05730) | 1276800..1277342 | - | 543 | WP_011097613.1 | hypothetical protein | - |
| OK119_RS05735 (OK119_05735) | 1277318..1277839 | - | 522 | WP_011097614.1 | hypothetical protein | - |
| OK119_RS05740 (OK119_05740) | 1277836..1278159 | - | 324 | WP_011097935.1 | hypothetical protein | - |
| OK119_RS05745 (OK119_05745) | 1278159..1278419 | - | 261 | WP_038232801.1 | hypothetical protein | - |
| OK119_RS05750 (OK119_05750) | 1278437..1280311 | - | 1875 | WP_140161278.1 | phage major capsid protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1262235..1308442 | 46207 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10936.37 Da Isoelectric Point: 7.2205
>T262297 WP_004090909.1 NZ_CP109890:1275898-1276179 [Xylella fastidiosa subsp. fastidiosa]
MRRISQTGQFKRDYKREAKGQHRATLDEELIHVLEALTCDHPLEPRHHDHALTGDWKDHRDCHIKPDLVLIYRKPDNETL
QLVRIGSHSELGL
MRRISQTGQFKRDYKREAKGQHRATLDEELIHVLEALTCDHPLEPRHHDHALTGDWKDHRDCHIKPDLVLIYRKPDNETL
QLVRIGSHSELGL
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|