262296

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) FicTA/Fic(toxin)
Location 1184764..1185560 Replicon chromosome
Accession NZ_CP109890
Organism Xylella fastidiosa subsp. fastidiosa strain WM1-1

Toxin (Protein)


Gene name VbhT Uniprot ID Q87CQ8
Locus tag OK119_RS05210 Protein ID WP_004088112.1
Coordinates 1184764..1185375 (-) Length 204 a.a.

Antitoxin (Protein)


Gene name VbhA Uniprot ID B2I551
Locus tag OK119_RS05215 Protein ID WP_004088114.1
Coordinates 1185372..1185560 (-) Length 63 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OK119_RS05165 (OK119_05165) 1180219..1181106 - 888 WP_012382597.1 YdaU family protein -
OK119_RS05170 (OK119_05170) 1181103..1181891 - 789 WP_011097897.1 Bro-N domain-containing protein -
OK119_RS05175 (OK119_05175) 1181888..1182520 - 633 WP_004088094.1 Bro-N domain-containing protein -
OK119_RS05180 (OK119_05180) 1182517..1182780 - 264 WP_228446177.1 hypothetical protein -
OK119_RS05185 (OK119_05185) 1182798..1183013 - 216 WP_012382598.1 hypothetical protein -
OK119_RS05190 (OK119_05190) 1183043..1183231 - 189 WP_004088102.1 hypothetical protein -
OK119_RS05195 (OK119_05195) 1183259..1183450 - 192 WP_004088104.1 hypothetical protein -
OK119_RS05200 (OK119_05200) 1183709..1183954 - 246 WP_004088108.1 hypothetical protein -
OK119_RS05205 (OK119_05205) 1184039..1184713 + 675 WP_004088110.1 helix-turn-helix transcriptional regulator -
OK119_RS05210 (OK119_05210) 1184764..1185375 - 612 WP_004088112.1 Fic/DOC family protein Toxin
OK119_RS05215 (OK119_05215) 1185372..1185560 - 189 WP_004088114.1 antitoxin VbhA family protein Antitoxin
OK119_RS05220 (OK119_05220) 1185952..1186488 + 537 WP_038233020.1 hypothetical protein -
OK119_RS05225 (OK119_05225) 1186485..1186898 + 414 WP_004088056.1 DUF1566 domain-containing protein -
OK119_RS05230 (OK119_05230) 1186895..1187296 + 402 WP_004088054.1 hypothetical protein -
OK119_RS05235 (OK119_05235) 1187293..1187442 + 150 WP_012382602.1 hypothetical protein -
OK119_RS05240 (OK119_05240) 1187660..1187806 + 147 WP_225621633.1 hypothetical protein -
OK119_RS05245 (OK119_05245) 1187829..1188020 + 192 WP_012382603.1 hypothetical protein -
OK119_RS05250 (OK119_05250) 1188041..1188385 + 345 WP_004088346.1 hypothetical protein -
OK119_RS05255 (OK119_05255) 1188425..1189246 + 822 WP_004088345.1 DUF2303 family protein -
OK119_RS05260 (OK119_05260) 1189262..1190188 + 927 WP_004088344.1 phage recombination protein Bet -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1154600..1195310 40710


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(55-152)

Antitoxin

Antitoxin VbhA

(10-56)


Sequences

Toxin        


Download         Length: 204 a.a.        Molecular weight: 22832.60 Da        Isoelectric Point: 5.1271

>T262296 WP_004088112.1 NZ_CP109890:c1185375-1184764 [Xylella fastidiosa subsp. fastidiosa]
MKYAGDRGDPYLDSETGVLRNLLGIRDQGGLDKIESTLSFLRTSELRERPVKGKFDLAHLQEIHNRLFQDVYDWAGQIRQ
VEISKGNTMFAQQIAIQSAAQQIFGQLAKERFLCGLDAEEFSKRAGDYLGEINVLHPFREGNGRTQREFIAQLAQRAGYR
IDWGVVSQADMIKASIDAYNGDSSGLASIIREGISDQLFKDNE

Download         Length: 612 bp

Antitoxin


Download         Length: 63 a.a.        Molecular weight: 6837.77 Da        Isoelectric Point: 4.9859

>AT262296 WP_004088114.1 NZ_CP109890:c1185560-1185372 [Xylella fastidiosa subsp. fastidiosa]
MLTDHEKAERRAVVQSALASQRIEGLEPDAQAVVDAECWARGEMTIAAAVDQYKARVRLQIA

Download         Length: 189 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q87CQ8

Antitoxin

Source ID Structure
AlphaFold DB B2I551

References