262295

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) pasABC/RelE-HTH
Location 1161187..1161664 Replicon chromosome
Accession NZ_CP109890
Organism Xylella fastidiosa subsp. fastidiosa strain WM1-1

Toxin (Protein)


Gene name pasB Uniprot ID Q87CA4
Locus tag OK119_RS05020 Protein ID WP_011097988.1
Coordinates 1161398..1161664 (+) Length 89 a.a.

Antitoxin (Protein)


Gene name pasA Uniprot ID A0A7G7TPD2
Locus tag OK119_RS05015 Protein ID WP_004091377.1
Coordinates 1161187..1161414 (+) Length 76 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OK119_RS04970 (OK119_04970) 1156324..1156524 - 201 WP_236641891.1 hypothetical protein -
OK119_RS04975 (OK119_04975) 1156575..1157459 - 885 WP_236641892.1 baseplate J/gp47 family protein -
OK119_RS04980 (OK119_04980) 1157558..1157854 + 297 WP_004089252.1 type II toxin-antitoxin system RelE/ParE family toxin -
OK119_RS04985 (OK119_04985) 1157858..1158163 + 306 WP_004089254.1 putative addiction module antidote protein -
OK119_RS04990 (OK119_04990) 1158174..1158527 - 354 WP_011097986.1 hypothetical protein -
OK119_RS04995 (OK119_04995) 1158524..1159165 - 642 WP_004090764.1 Gp138 family membrane-puncturing spike protein -
OK119_RS05000 (OK119_05000) 1159162..1159992 - 831 WP_004090766.1 hypothetical protein -
OK119_RS05005 (OK119_05005) 1159989..1160306 - 318 WP_011097873.1 hypothetical protein -
OK119_RS05010 (OK119_05010) 1160306..1161076 - 771 WP_004090769.1 hypothetical protein -
OK119_RS05015 (OK119_05015) 1161187..1161414 + 228 WP_004091377.1 DUF6290 family protein Antitoxin
OK119_RS05020 (OK119_05020) 1161398..1161664 + 267 WP_011097988.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
OK119_RS05025 (OK119_05025) 1161675..1163468 - 1794 WP_228446142.1 phage tail tape measure protein -
OK119_RS05030 (OK119_05030) 1163521..1163685 - 165 WP_162849007.1 hypothetical protein -
OK119_RS05035 (OK119_05035) 1163712..1164134 - 423 WP_012382587.1 putative phage tail assembly chaperone -
OK119_RS05040 (OK119_05040) 1164131..1164568 - 438 WP_011097990.1 DUF3277 family protein -
OK119_RS05045 (OK119_05045) 1164578..1166074 - 1497 WP_038232978.1 DUF3383 domain-containing protein -
OK119_RS05050 (OK119_05050) 1166075..1166608 - 534 WP_004090297.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1154600..1195310 40710


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-87)

Antitoxin

Protein of unknown function DUF6290

(1-71)


Sequences

Toxin        


Download         Length: 89 a.a.        Molecular weight: 10163.79 Da        Isoelectric Point: 10.6086

>T262295 WP_011097988.1 NZ_CP109890:1161398-1161664 [Xylella fastidiosa subsp. fastidiosa]
MAWTIDYTDTAKQQLRKLDKHMARRIVDFMDERIAGLENPRSSGKALTGPLGGFWRYRVGDFRVVCAIQDSVLRVLVVRV
GHRGEIYR

Download         Length: 267 bp

Antitoxin


Download         Length: 76 a.a.        Molecular weight: 8615.63 Da        Isoelectric Point: 5.0958

>AT262295 WP_004091377.1 NZ_CP109890:1161187-1161414 [Xylella fastidiosa subsp. fastidiosa]
MATSIRLSPEMEQRLNSLASHTGRTKAYYLREIIEHGIEEMEDYYLAADVLERVRHGQEQVHSAADVRKTLGLDD

Download         Length: 228 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A060HDH1

Antitoxin

Source ID Structure
AlphaFold DB A0A7G7TPD2

References