Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | pasABC/RelE-HTH |
Location | 1161187..1161664 | Replicon | chromosome |
Accession | NZ_CP109890 | ||
Organism | Xylella fastidiosa subsp. fastidiosa strain WM1-1 |
Toxin (Protein)
Gene name | pasB | Uniprot ID | Q87CA4 |
Locus tag | OK119_RS05020 | Protein ID | WP_011097988.1 |
Coordinates | 1161398..1161664 (+) | Length | 89 a.a. |
Antitoxin (Protein)
Gene name | pasA | Uniprot ID | A0A7G7TPD2 |
Locus tag | OK119_RS05015 | Protein ID | WP_004091377.1 |
Coordinates | 1161187..1161414 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OK119_RS04970 (OK119_04970) | 1156324..1156524 | - | 201 | WP_236641891.1 | hypothetical protein | - |
OK119_RS04975 (OK119_04975) | 1156575..1157459 | - | 885 | WP_236641892.1 | baseplate J/gp47 family protein | - |
OK119_RS04980 (OK119_04980) | 1157558..1157854 | + | 297 | WP_004089252.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
OK119_RS04985 (OK119_04985) | 1157858..1158163 | + | 306 | WP_004089254.1 | putative addiction module antidote protein | - |
OK119_RS04990 (OK119_04990) | 1158174..1158527 | - | 354 | WP_011097986.1 | hypothetical protein | - |
OK119_RS04995 (OK119_04995) | 1158524..1159165 | - | 642 | WP_004090764.1 | Gp138 family membrane-puncturing spike protein | - |
OK119_RS05000 (OK119_05000) | 1159162..1159992 | - | 831 | WP_004090766.1 | hypothetical protein | - |
OK119_RS05005 (OK119_05005) | 1159989..1160306 | - | 318 | WP_011097873.1 | hypothetical protein | - |
OK119_RS05010 (OK119_05010) | 1160306..1161076 | - | 771 | WP_004090769.1 | hypothetical protein | - |
OK119_RS05015 (OK119_05015) | 1161187..1161414 | + | 228 | WP_004091377.1 | DUF6290 family protein | Antitoxin |
OK119_RS05020 (OK119_05020) | 1161398..1161664 | + | 267 | WP_011097988.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OK119_RS05025 (OK119_05025) | 1161675..1163468 | - | 1794 | WP_228446142.1 | phage tail tape measure protein | - |
OK119_RS05030 (OK119_05030) | 1163521..1163685 | - | 165 | WP_162849007.1 | hypothetical protein | - |
OK119_RS05035 (OK119_05035) | 1163712..1164134 | - | 423 | WP_012382587.1 | putative phage tail assembly chaperone | - |
OK119_RS05040 (OK119_05040) | 1164131..1164568 | - | 438 | WP_011097990.1 | DUF3277 family protein | - |
OK119_RS05045 (OK119_05045) | 1164578..1166074 | - | 1497 | WP_038232978.1 | DUF3383 domain-containing protein | - |
OK119_RS05050 (OK119_05050) | 1166075..1166608 | - | 534 | WP_004090297.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1154600..1195310 | 40710 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 89 a.a. Molecular weight: 10163.79 Da Isoelectric Point: 10.6086
>T262295 WP_011097988.1 NZ_CP109890:1161398-1161664 [Xylella fastidiosa subsp. fastidiosa]
MAWTIDYTDTAKQQLRKLDKHMARRIVDFMDERIAGLENPRSSGKALTGPLGGFWRYRVGDFRVVCAIQDSVLRVLVVRV
GHRGEIYR
MAWTIDYTDTAKQQLRKLDKHMARRIVDFMDERIAGLENPRSSGKALTGPLGGFWRYRVGDFRVVCAIQDSVLRVLVVRV
GHRGEIYR
Download Length: 267 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A060HDH1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7G7TPD2 |