Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumA-relB/COG3657-DUF971 |
| Location | 1157558..1158163 | Replicon | chromosome |
| Accession | NZ_CP109890 | ||
| Organism | Xylella fastidiosa subsp. fastidiosa strain WM1-1 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | B2I5N3 |
| Locus tag | OK119_RS04980 | Protein ID | WP_004089252.1 |
| Coordinates | 1157558..1157854 (+) | Length | 99 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | OK119_RS04985 | Protein ID | WP_004089254.1 |
| Coordinates | 1157858..1158163 (+) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OK119_RS04950 (OK119_04950) | 1152725..1153729 | - | 1005 | WP_128723193.1 | peptidase | - |
| OK119_RS04955 (OK119_04955) | 1153889..1154086 | - | 198 | WP_012382581.1 | hypothetical protein | - |
| OK119_RS04960 (OK119_04960) | 1154600..1155763 | - | 1164 | WP_038232954.1 | tail fiber protein | - |
| OK119_RS04965 (OK119_04965) | 1155767..1156327 | - | 561 | WP_014607744.1 | DUF2612 domain-containing protein | - |
| OK119_RS04970 (OK119_04970) | 1156324..1156524 | - | 201 | WP_236641891.1 | hypothetical protein | - |
| OK119_RS04975 (OK119_04975) | 1156575..1157459 | - | 885 | WP_236641892.1 | baseplate J/gp47 family protein | - |
| OK119_RS04980 (OK119_04980) | 1157558..1157854 | + | 297 | WP_004089252.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OK119_RS04985 (OK119_04985) | 1157858..1158163 | + | 306 | WP_004089254.1 | putative addiction module antidote protein | Antitoxin |
| OK119_RS04990 (OK119_04990) | 1158174..1158527 | - | 354 | WP_011097986.1 | hypothetical protein | - |
| OK119_RS04995 (OK119_04995) | 1158524..1159165 | - | 642 | WP_004090764.1 | Gp138 family membrane-puncturing spike protein | - |
| OK119_RS05000 (OK119_05000) | 1159162..1159992 | - | 831 | WP_004090766.1 | hypothetical protein | - |
| OK119_RS05005 (OK119_05005) | 1159989..1160306 | - | 318 | WP_011097873.1 | hypothetical protein | - |
| OK119_RS05010 (OK119_05010) | 1160306..1161076 | - | 771 | WP_004090769.1 | hypothetical protein | - |
| OK119_RS05015 (OK119_05015) | 1161187..1161414 | + | 228 | WP_004091377.1 | DUF6290 family protein | - |
| OK119_RS05020 (OK119_05020) | 1161398..1161664 | + | 267 | WP_011097988.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1154600..1195310 | 40710 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 10790.57 Da Isoelectric Point: 10.0509
>T262294 WP_004089252.1 NZ_CP109890:1157558-1157854 [Xylella fastidiosa subsp. fastidiosa]
MVELIKTSTFDAWINSLRDRKAAARIQARLDRLALGNPGDVKPVGAGISEMRIDHGPGYRIYFMKHGAVLILLLCGGDKS
SQVRDIEQAKALAALWKD
MVELIKTSTFDAWINSLRDRKAAARIQARLDRLALGNPGDVKPVGAGISEMRIDHGPGYRIYFMKHGAVLILLLCGGDKS
SQVRDIEQAKALAALWKD
Download Length: 297 bp
Antitoxin
Download Length: 102 a.a. Molecular weight: 10983.37 Da Isoelectric Point: 5.0941
>AT262294 WP_004089254.1 NZ_CP109890:1157858-1158163 [Xylella fastidiosa subsp. fastidiosa]
MNNETFSRYDTADYLKTEEDIAAYMEAVMEEGGRDNPAFIARALGAVARARNLSQLARDVGMSRQGLDKALSNDGNPSFS
TILKVAKALGLRMSFTPSSMS
MNNETFSRYDTADYLKTEEDIAAYMEAVMEEGGRDNPAFIARALGAVARARNLSQLARDVGMSRQGLDKALSNDGNPSFS
TILKVAKALGLRMSFTPSSMS
Download Length: 306 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|