Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapC-ata/VapC-Ata
Location 22415..23241 Replicon plasmid pXF-P2CFBP8073
Accession NZ_CP109889
Organism Xylella fastidiosa subsp. fastidiosa strain CFBP8073

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag OK117_RS12600 Protein ID WP_199276045.1
Coordinates 22415..22858 (+) Length 148 a.a.

Antitoxin (Protein)


Gene name ata Uniprot ID -
Locus tag OK117_RS12605 Protein ID WP_058565084.1
Coordinates 22918..23241 (+) Length 108 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OK117_RS12565 (OK117_12575) 18012..18395 - 384 WP_013087959.1 VirB3 family type IV secretion system protein -
OK117_RS12570 (OK117_12580) 18400..18720 - 321 WP_058564991.1 TrbC/VirB2 family protein -
OK117_RS12575 (OK117_12585) 18723..19202 - 480 WP_081046867.1 hypothetical protein -
OK117_RS12580 (OK117_12590) 19205..19384 - 180 WP_081046870.1 hypothetical protein -
OK117_RS12585 (OK117_12595) 20203..20418 - 216 WP_058564999.1 helix-turn-helix transcriptional regulator -
OK117_RS12590 (OK117_12600) 20716..21480 + 765 WP_272143429.1 hypothetical protein -
OK117_RS12595 (OK117_12605) 22164..22418 + 255 WP_058565086.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
OK117_RS12600 (OK117_12610) 22415..22858 + 444 WP_199276045.1 type II toxin-antitoxin system VapC family toxin Toxin
OK117_RS12605 (OK117_12615) 22918..23241 + 324 WP_058565084.1 helix-turn-helix transcriptional regulator Antitoxin
OK117_RS12610 (OK117_12620) 23488..23811 - 324 WP_058565083.1 hypothetical protein -
OK117_RS12615 (OK117_12625) 23974..24204 - 231 WP_058565082.1 DUF6290 family protein -
OK117_RS12620 (OK117_12630) 24714..25127 + 414 WP_058565080.1 hypothetical protein -
OK117_RS12625 (OK117_12635) 25277..25702 - 426 WP_058565079.1 type II toxin-antitoxin system VapC family toxin -
OK117_RS12630 (OK117_12640) 25699..25956 - 258 WP_058565078.1 hypothetical protein -
OK117_RS12635 (OK117_12645) 26140..26742 + 603 WP_272143436.1 recombinase family protein -
OK117_RS12640 (OK117_12650) 26739..27605 + 867 WP_230950003.1 plasmid replication initiator TrfA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..28508 28508


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(3-123)

Antitoxin

HigA2-like, helix-turn-helix domain

(11-89)


Sequences

Toxin        


Download         Length: 148 a.a.        Molecular weight: 16431.88 Da        Isoelectric Point: 4.6233

>T262289 WP_199276045.1 NZ_CP109889:22415-22858 [Xylella fastidiosa subsp. fastidiosa]
MMYVLDTNVVSELRKIQVGKADSNVAAWTQSVDASELFVSAITIMELELGVLSIERKDITQGTLLRIWMEQHVLPEFSER
TLPVDTVVALRCAQLHVPDRCDERDALIAATALVHGMAVVTRNVADFQPTGVTILNPWEWRSHTCSE

Download         Length: 444 bp

Antitoxin


Download         Length: 108 a.a.        Molecular weight: 11542.48 Da        Isoelectric Point: 4.3085

>AT262289 WP_058565084.1 NZ_CP109889:22918-23241 [Xylella fastidiosa subsp. fastidiosa]
MIEIEEGSGNVYADLVILDADEMLVKAQLATKIGEIIKGRGWTQQEVADVLGMTQPKLSKMLLGQFRGISEAKMLECLAQ
LGWQVQIVVGPACLTNDAGHVEVAFVA

Download         Length: 324 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References