Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) pemIK/PRK09812-MazE
Location 4663..5249 Replicon plasmid pXF-P2CFBP8073
Accession NZ_CP109889
Organism Xylella fastidiosa subsp. fastidiosa strain CFBP8073

Toxin (Protein)


Gene name pemK Uniprot ID A0A060HFN7
Locus tag OK117_RS12510 Protein ID WP_038230332.1
Coordinates 4923..5249 (+) Length 109 a.a.

Antitoxin (Protein)


Gene name pemI Uniprot ID -
Locus tag OK117_RS12505 Protein ID WP_038211571.1
Coordinates 4663..4926 (+) Length 88 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OK117_RS12465 (OK117_12475) 43..321 + 279 WP_024748579.1 type II toxin-antitoxin system RelB/DinJ family antitoxin -
OK117_RS12470 (OK117_12480) 293..622 + 330 WP_024748578.1 type II toxin-antitoxin system YafQ family toxin -
OK117_RS12475 (OK117_12485) 753..1196 - 444 WP_014607318.1 hypothetical protein -
OK117_RS12480 (OK117_12490) 1197..1949 - 753 WP_058564981.1 conjugal transfer protein TraL -
OK117_RS12485 (OK117_12495) 1962..2222 - 261 WP_199276035.1 hypothetical protein -
OK117_RS12490 (OK117_12500) 2595..3224 + 630 WP_233341820.1 plasmid mobilization relaxosome protein MobC -
OK117_RS12495 (OK117_12505) 3243..3497 + 255 WP_014607322.1 hypothetical protein -
OK117_RS12500 (OK117_12510) 3503..4603 + 1101 WP_038211569.1 zeta toxin family protein -
OK117_RS12505 (OK117_12515) 4663..4926 + 264 WP_038211571.1 antitoxin Antitoxin
OK117_RS12510 (OK117_12520) 4923..5249 + 327 WP_038230332.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
OK117_RS12515 (OK117_12525) 5308..6444 - 1137 WP_233341821.1 relaxase/mobilization nuclease domain-containing protein -
OK117_RS12520 (OK117_12530) 6510..7616 - 1107 WP_058564982.1 hypothetical protein -
OK117_RS12525 (OK117_12535) 7629..9905 - 2277 WP_058564983.1 type IV secretory system conjugative DNA transfer family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..28508 28508


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(1-102)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 109 a.a.        Molecular weight: 11795.71 Da        Isoelectric Point: 8.5480

>T262288 WP_038230332.1 NZ_CP109889:4923-5249 [Xylella fastidiosa subsp. fastidiosa]
MKRGDVYMVDLEPTAGHEQRGHRPVVVISSERFNRLTSCPVILPITNGGEFASRLGFAVELLGTITTGVVRCDQPRALDL
LARNARKVESLPPNILADVLAKAVTIFQ

Download         Length: 327 bp

Antitoxin


Download         Length: 88 a.a.        Molecular weight: 9377.83 Da        Isoelectric Point: 4.3588

>AT262288 WP_038211571.1 NZ_CP109889:4663-4926 [Xylella fastidiosa subsp. fastidiosa]
MHTTNLRKVGGSIMLAVPPAFLDQLHLEVGAAVGLVITDGRLVIEPVLHPQYTLDQLLAEAEASGAYPLPPEEREWVDAP
AVGRELI

Download         Length: 264 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A060HFN7

Antitoxin

Source ID Structure

References