Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relE-dinJ/YafQ-RelB
Location 16210..16744 Replicon plasmid pXF-P1CFBP8073
Accession NZ_CP109888
Organism Xylella fastidiosa subsp. fastidiosa strain CFBP8073

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag OK117_RS12305 Protein ID WP_272143375.1
Coordinates 16210..16491 (-) Length 94 a.a.

Antitoxin (Protein)


Gene name dinJ Uniprot ID -
Locus tag OK117_RS12310 Protein ID WP_154415118.1
Coordinates 16478..16744 (-) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OK117_RS12285 (OK117_12295) 11861..13870 + 2010 WP_233341848.1 type IV secretory system conjugative DNA transfer family protein -
OK117_RS12290 (OK117_12300) 13880..14785 + 906 WP_272143370.1 hypothetical protein -
OK117_RS12295 (OK117_12305) 14751..15989 + 1239 WP_272143373.1 hypothetical protein -
OK117_RS12300 (OK117_12310) 15986..16186 + 201 WP_058565126.1 hypothetical protein -
OK117_RS12305 (OK117_12315) 16210..16491 - 282 WP_272143375.1 type II toxin-antitoxin system YafQ family toxin Toxin
OK117_RS12310 (OK117_12320) 16478..16744 - 267 WP_154415118.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
OK117_RS12315 (OK117_12325) 16823..16966 - 144 Protein_19 hypothetical protein -
OK117_RS12320 (OK117_12330) 16979..17572 - 594 WP_272143379.1 recombinase family protein -
OK117_RS12325 (OK117_12335) 17783..18025 + 243 WP_058565093.1 type II toxin-antitoxin system ParD family antitoxin -
OK117_RS12330 (OK117_12340) 18087..18395 - 309 WP_058565094.1 type II toxin-antitoxin system RelE/ParE family toxin -
OK117_RS12335 (OK117_12345) 18399..18683 - 285 WP_058565097.1 hypothetical protein -
OK117_RS12340 (OK117_12350) 18758..19213 - 456 WP_058565095.1 hypothetical protein -
OK117_RS12345 (OK117_12355) 19743..20951 - 1209 WP_058565098.1 RNA-guided endonuclease TnpB family protein -
OK117_RS12350 (OK117_12360) 20974..21390 + 417 WP_272143408.1 IS200/IS605 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - - 1..38041 38041


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-92)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(7-78)


Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 10759.29 Da        Isoelectric Point: 9.8434

>T262287 WP_272143375.1 NZ_CP109888:c16491-16210 [Xylella fastidiosa subsp. fastidiosa]
MRMIDRSLAFKRDYKREAKGRWRATLDNDLRPVLVALATDQPLAAKYRDHDLSGDWAGYRECHAKPDLLLIYRKSDADTL
RLARLGSHSELFG

Download         Length: 282 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 9704.05 Da        Isoelectric Point: 5.1392

>AT262287 WP_154415118.1 NZ_CP109888:c16744-16478 [Xylella fastidiosa subsp. fastidiosa]
MSAADTYVRARIDTKTKERAADALEAMGLSISDAIRLLMLRVADERRLPFDVKVPNTTTRNAIAELEAGKGKRFANVDDL
MADLHADD

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References