Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/upstrm_HI1419-dnstrm_HI1420 |
Location | 2638164..2638775 | Replicon | chromosome |
Accession | NZ_CP109886 | ||
Organism | Xylella fastidiosa subsp. fastidiosa strain CFBP8073 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A060HHU8 |
Locus tag | OK117_RS12075 | Protein ID | WP_024749166.1 |
Coordinates | 2638476..2638775 (-) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | Q879U0 |
Locus tag | OK117_RS12070 | Protein ID | WP_004085003.1 |
Coordinates | 2638164..2638472 (-) | Length | 103 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OK117_RS12040 (OK117_12050) | 2634743..2635504 | - | 762 | WP_004090267.1 | Bax inhibitor-1/YccA family protein | - |
OK117_RS12065 (OK117_12075) | 2636696..2638090 | + | 1395 | WP_272142406.1 | hypothetical protein | - |
OK117_RS12070 (OK117_12080) | 2638164..2638472 | - | 309 | WP_004085003.1 | putative addiction module antidote protein | Antitoxin |
OK117_RS12075 (OK117_12085) | 2638476..2638775 | - | 300 | WP_024749166.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OK117_RS12080 (OK117_12090) | 2638863..2639405 | + | 543 | WP_272142416.1 | hypothetical protein | - |
OK117_RS12085 (OK117_12095) | 2639417..2639560 | + | 144 | WP_200904642.1 | hypothetical protein | - |
OK117_RS12090 (OK117_12100) | 2639726..2640121 | - | 396 | Protein_2358 | DUF596 domain-containing protein | - |
OK117_RS12095 (OK117_12105) | 2640126..2641487 | - | 1362 | WP_272142420.1 | DUF769 domain-containing protein | - |
OK117_RS12100 (OK117_12110) | 2641567..2641710 | + | 144 | WP_272142424.1 | hypothetical protein | - |
OK117_RS12105 (OK117_12115) | 2641863..2642239 | - | 377 | Protein_2361 | DUF596 domain-containing protein | - |
OK117_RS12110 (OK117_12120) | 2642244..2642600 | - | 357 | WP_058565148.1 | DUF769 domain-containing protein | - |
OK117_RS12115 (OK117_12125) | 2642815..2643201 | - | 387 | WP_058565149.1 | DUF596 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11364.14 Da Isoelectric Point: 10.3861
>T262286 WP_024749166.1 NZ_CP109886:c2638775-2638476 [Xylella fastidiosa subsp. fastidiosa]
MTYTVKRLEGFSDWLKGLKDGLARQRLIKRLRKVQLGNFGDVQPVGEGVFEMREHFGPGWRMYYVQRGSFLIVMLGGGDK
STQQSDIRRAIELAKSLED
MTYTVKRLEGFSDWLKGLKDGLARQRLIKRLRKVQLGNFGDVQPVGEGVFEMREHFGPGWRMYYVQRGSFLIVMLGGGDK
STQQSDIRRAIELAKSLED
Download Length: 300 bp
Antitoxin
Download Length: 103 a.a. Molecular weight: 11060.61 Da Isoelectric Point: 4.6535
>AT262286 WP_004085003.1 NZ_CP109886:c2638472-2638164 [Xylella fastidiosa subsp. fastidiosa]
VTITKKINVSELPEFDAAEYLNSEEEVAAYLTAVLEENDPALLAAALGDIARSRGMSQIAKDSGITREALYKALRPGSEP
RFDTISRVCTALGIRLVAQPMH
VTITKKINVSELPEFDAAEYLNSEEEVAAYLTAVLEENDPALLAAALGDIARSRGMSQIAKDSGITREALYKALRPGSEP
RFDTISRVCTALGIRLVAQPMH
Download Length: 309 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A060HHU8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A060HCD4 |