Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/- |
| Location | 1606002..1606588 | Replicon | chromosome |
| Accession | NZ_CP109886 | ||
| Organism | Xylella fastidiosa subsp. fastidiosa strain CFBP8073 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | OK117_RS07280 | Protein ID | WP_080702508.1 |
| Coordinates | 1606334..1606588 (-) | Length | 85 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | B2I6C9 |
| Locus tag | OK117_RS07275 | Protein ID | WP_004085025.1 |
| Coordinates | 1606002..1606337 (-) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OK117_RS07245 (OK117_07260) | 1601601..1602512 | - | 912 | WP_233341832.1 | iron-sulfur cluster carrier protein ApbC | - |
| OK117_RS07250 (OK117_07265) | 1602947..1603720 | + | 774 | WP_020852623.1 | 3-deoxy-manno-octulosonate cytidylyltransferase | - |
| OK117_RS07255 (OK117_07270) | 1603717..1604181 | + | 465 | WP_058565046.1 | low molecular weight protein-tyrosine-phosphatase | - |
| OK117_RS07260 (OK117_07275) | 1604168..1604881 | - | 714 | WP_272141616.1 | site-specific DNA-methyltransferase | - |
| OK117_RS07265 (OK117_07280) | 1605232..1605513 | + | 282 | WP_031337809.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| OK117_RS07270 (OK117_07285) | 1605523..1605822 | + | 300 | WP_004089519.1 | HigA family addiction module antitoxin | - |
| OK117_RS07275 (OK117_07290) | 1606002..1606337 | - | 336 | WP_004085025.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| OK117_RS07280 (OK117_07295) | 1606334..1606588 | - | 255 | WP_080702508.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| OK117_RS07285 (OK117_07300) | 1606641..1607339 | - | 699 | WP_272141619.1 | hypothetical protein | - |
| OK117_RS07290 (OK117_07305) | 1607468..1607929 | - | 462 | WP_272141621.1 | hypothetical protein | - |
| OK117_RS07295 (OK117_07310) | 1607926..1608690 | - | 765 | WP_272141623.1 | hypothetical protein | - |
| OK117_RS07300 (OK117_07315) | 1608596..1609659 | - | 1064 | Protein_1421 | YdaU family protein | - |
| OK117_RS07305 (OK117_07320) | 1609656..1610054 | - | 399 | WP_235443704.1 | hypothetical protein | - |
| OK117_RS07310 (OK117_07325) | 1610058..1610432 | + | 375 | WP_004091110.1 | conjugal transfer protein | - |
| OK117_RS07315 (OK117_07330) | 1610438..1611040 | + | 603 | WP_058565172.1 | conjugal transfer protein TrbN | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1579097..1625836 | 46739 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 85 a.a. Molecular weight: 9661.19 Da Isoelectric Point: 11.5325
>T262285 WP_080702508.1 NZ_CP109886:c1606588-1606334 [Xylella fastidiosa subsp. fastidiosa]
MKRKHAKTLSAIYTRPVSANIQWRHIEALFVELGAKVEEREGSRMLVRLFGERRIFHRPHPSPNTDKGAVESIRAWLKSN
GVTP
MKRKHAKTLSAIYTRPVSANIQWRHIEALFVELGAKVEEREGSRMLVRLFGERRIFHRPHPSPNTDKGAVESIRAWLKSN
GVTP
Download Length: 255 bp
Antitoxin
Download Length: 112 a.a. Molecular weight: 12324.07 Da Isoelectric Point: 5.6556
>AT262285 WP_004085025.1 NZ_CP109886:c1606337-1606002 [Xylella fastidiosa subsp. fastidiosa]
MKNIMTIESFKAIITYDPEIDMFRGEFVGINGGADFYAKDLKGLRREGAISLKVFLEACKEDSVEPRKCYSGKFNARISP
ELHALASEAAAAQGISLNQFVEQAIQHEVHT
MKNIMTIESFKAIITYDPEIDMFRGEFVGINGGADFYAKDLKGLRREGAISLKVFLEACKEDSVEPRKCYSGKFNARISP
ELHALASEAAAAQGISLNQFVEQAIQHEVHT
Download Length: 336 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|