Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/LOTUS_5_Limkain_b1-VagC
Location 1416654..1417327 Replicon chromosome
Accession NZ_CP109886
Organism Xylella fastidiosa subsp. fastidiosa strain CFBP8073

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag OK117_RS06415 Protein ID WP_024748528.1
Coordinates 1416923..1417327 (+) Length 135 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID -
Locus tag OK117_RS06410 Protein ID WP_038230657.1
Coordinates 1416654..1416926 (+) Length 91 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OK117_RS06370 (OK117_06385) 1411732..1412877 - 1146 WP_272141491.1 baseplate J/gp47 family protein -
OK117_RS06375 (OK117_06390) 1412976..1413272 + 297 WP_004089252.1 type II toxin-antitoxin system RelE/ParE family toxin -
OK117_RS06380 (OK117_06395) 1413276..1413581 + 306 WP_004089254.1 putative addiction module antidote protein -
OK117_RS06385 (OK117_06400) 1413592..1413945 - 354 WP_272141493.1 hypothetical protein -
OK117_RS06390 (OK117_06405) 1413942..1414583 - 642 WP_272141495.1 Gp138 family membrane-puncturing spike protein -
OK117_RS06395 (OK117_06410) 1414580..1415410 - 831 WP_272141497.1 hypothetical protein -
OK117_RS06400 (OK117_06415) 1415407..1415724 - 318 WP_011097873.1 hypothetical protein -
OK117_RS06405 (OK117_06420) 1415724..1416494 - 771 WP_272141499.1 hypothetical protein -
OK117_RS06410 (OK117_06425) 1416654..1416926 + 273 WP_038230657.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
OK117_RS06415 (OK117_06430) 1416923..1417327 + 405 WP_024748528.1 type II toxin-antitoxin system VapC family toxin Toxin
OK117_RS06420 (OK117_06435) 1417346..1419235 - 1890 WP_057683614.1 hypothetical protein -
OK117_RS06425 (OK117_06440) 1419383..1419805 - 423 WP_057683613.1 putative phage tail assembly chaperone -
OK117_RS06430 (OK117_06445) 1419802..1420239 - 438 WP_272141507.1 DUF3277 family protein -
OK117_RS06435 (OK117_06450) 1420249..1420482 - 234 WP_272141509.1 DUF3383 family protein -
OK117_RS06440 (OK117_06455) 1420499..1421377 - 879 WP_081046894.1 RNA-guided endonuclease TnpB family protein -
OK117_RS06445 (OK117_06460) 1421543..1421704 - 162 WP_014607806.1 helix-turn-helix domain-containing protein -
OK117_RS06450 (OK117_06465) 1421698..1422303 - 606 Protein_1253 IS607 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1408141..1428401 20260
- flank IS/Tn - - 1421698..1421919 221


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(4-124)

Antitoxin

SpoVT-AbrB domain

(16-54)


Sequences

Toxin        


Download         Length: 135 a.a.        Molecular weight: 14653.95 Da        Isoelectric Point: 5.6881

>T262284 WP_024748528.1 NZ_CP109886:1416923-1417327 [Xylella fastidiosa subsp. fastidiosa]
VSGYMLDTNIISDIIRNPFGAVACRIEHVGYPNICTSVIVAAELRYGCTKNGSVKLLSRVQDILKTLPILPLDIPVDTTY
GSIRAELEAAGQLIGANDLLIAAHAYVLGLTLVTDNTREFSRIRGLDVQNWLER

Download         Length: 405 bp

Antitoxin


Download         Length: 91 a.a.        Molecular weight: 10493.00 Da        Isoelectric Point: 4.7010

>AT262284 WP_038230657.1 NZ_CP109886:1416654-1416926 [Xylella fastidiosa subsp. fastidiosa]
MPISSPLSRTKEAKLFRNNRSQAVRIPVEFELPGDRVLIHREGSKLIIEPITRPTNIVELLHEWRRETPLDPEDQFPDID
DMPVQPEDIL

Download         Length: 273 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References