Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumA-relB/COG3657-DUF971 |
| Location | 1412976..1413581 | Replicon | chromosome |
| Accession | NZ_CP109886 | ||
| Organism | Xylella fastidiosa subsp. fastidiosa strain CFBP8073 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | B2I5N3 |
| Locus tag | OK117_RS06375 | Protein ID | WP_004089252.1 |
| Coordinates | 1412976..1413272 (+) | Length | 99 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | OK117_RS06380 | Protein ID | WP_004089254.1 |
| Coordinates | 1413276..1413581 (+) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OK117_RS06350 (OK117_06365) | 1408141..1409118 | + | 978 | WP_058564885.1 | hypothetical protein | - |
| OK117_RS06355 (OK117_06370) | 1409377..1409823 | + | 447 | WP_058564886.1 | hypothetical protein | - |
| OK117_RS06360 (OK117_06375) | 1409927..1411171 | - | 1245 | WP_272141487.1 | phage tail protein | - |
| OK117_RS06365 (OK117_06380) | 1411175..1411735 | - | 561 | WP_272141489.1 | DUF2612 domain-containing protein | - |
| OK117_RS06370 (OK117_06385) | 1411732..1412877 | - | 1146 | WP_272141491.1 | baseplate J/gp47 family protein | - |
| OK117_RS06375 (OK117_06390) | 1412976..1413272 | + | 297 | WP_004089252.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OK117_RS06380 (OK117_06395) | 1413276..1413581 | + | 306 | WP_004089254.1 | putative addiction module antidote protein | Antitoxin |
| OK117_RS06385 (OK117_06400) | 1413592..1413945 | - | 354 | WP_272141493.1 | hypothetical protein | - |
| OK117_RS06390 (OK117_06405) | 1413942..1414583 | - | 642 | WP_272141495.1 | Gp138 family membrane-puncturing spike protein | - |
| OK117_RS06395 (OK117_06410) | 1414580..1415410 | - | 831 | WP_272141497.1 | hypothetical protein | - |
| OK117_RS06400 (OK117_06415) | 1415407..1415724 | - | 318 | WP_011097873.1 | hypothetical protein | - |
| OK117_RS06405 (OK117_06420) | 1415724..1416494 | - | 771 | WP_272141499.1 | hypothetical protein | - |
| OK117_RS06410 (OK117_06425) | 1416654..1416926 | + | 273 | WP_038230657.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
| OK117_RS06415 (OK117_06430) | 1416923..1417327 | + | 405 | WP_024748528.1 | type II toxin-antitoxin system VapC family toxin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1408141..1428401 | 20260 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 10790.57 Da Isoelectric Point: 10.0509
>T262283 WP_004089252.1 NZ_CP109886:1412976-1413272 [Xylella fastidiosa subsp. fastidiosa]
MVELIKTSTFDAWINSLRDRKAAARIQARLDRLALGNPGDVKPVGAGISEMRIDHGPGYRIYFMKHGAVLILLLCGGDKS
SQVRDIEQAKALAALWKD
MVELIKTSTFDAWINSLRDRKAAARIQARLDRLALGNPGDVKPVGAGISEMRIDHGPGYRIYFMKHGAVLILLLCGGDKS
SQVRDIEQAKALAALWKD
Download Length: 297 bp
Antitoxin
Download Length: 102 a.a. Molecular weight: 10983.37 Da Isoelectric Point: 5.0941
>AT262283 WP_004089254.1 NZ_CP109886:1413276-1413581 [Xylella fastidiosa subsp. fastidiosa]
MNNETFSRYDTADYLKTEEDIAAYMEAVMEEGGRDNPAFIARALGAVARARNLSQLARDVGMSRQGLDKALSNDGNPSFS
TILKVAKALGLRMSFTPSSMS
MNNETFSRYDTADYLKTEEDIAAYMEAVMEEGGRDNPAFIARALGAVARARNLSQLARDVGMSRQGLDKALSNDGNPSFS
TILKVAKALGLRMSFTPSSMS
Download Length: 306 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|