Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacT-ataR/DUF1778(antitoxin) |
| Location | 1027447..1028201 | Replicon | chromosome |
| Accession | NZ_CP109886 | ||
| Organism | Xylella fastidiosa subsp. fastidiosa strain CFBP8073 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | - |
| Locus tag | OK117_RS04365 | Protein ID | WP_199276042.1 |
| Coordinates | 1027447..1027926 (-) | Length | 160 a.a. |
Antitoxin (Protein)
| Gene name | ataR | Uniprot ID | - |
| Locus tag | OK117_RS04370 | Protein ID | WP_023908223.1 |
| Coordinates | 1027929..1028201 (-) | Length | 91 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OK117_RS04340 (OK117_04355) | 1022665..1023555 | + | 891 | Protein_837 | TrbI/VirB10 family protein | - |
| OK117_RS04345 (OK117_04360) | 1023574..1024359 | + | 786 | WP_046417519.1 | P-type conjugative transfer protein TrbJ | - |
| OK117_RS04350 (OK117_04365) | 1024372..1024686 | + | 315 | WP_155561293.1 | EexN family lipoprotein | - |
| OK117_RS04355 (OK117_04370) | 1024692..1026057 | + | 1366 | Protein_840 | P-type conjugative transfer protein TrbL | - |
| OK117_RS04360 (OK117_04375) | 1026063..1026665 | + | 603 | WP_058565172.1 | conjugal transfer protein TrbN | - |
| OK117_RS04365 (OK117_04380) | 1027447..1027926 | - | 480 | WP_199276042.1 | GNAT family N-acetyltransferase | Toxin |
| OK117_RS04370 (OK117_04385) | 1027929..1028201 | - | 273 | WP_023908223.1 | DUF1778 domain-containing protein | Antitoxin |
| OK117_RS04375 (OK117_04390) | 1028284..1029012 | - | 729 | WP_081046878.1 | DapH/DapD/GlmU-related protein | - |
| OK117_RS04380 (OK117_04395) | 1029018..1029353 | - | 336 | WP_058565069.1 | hypothetical protein | - |
| OK117_RS04385 (OK117_04400) | 1029992..1030411 | - | 420 | WP_004085763.1 | putative toxin-antitoxin system toxin component, PIN family | - |
| OK117_RS04390 (OK117_04405) | 1030411..1030650 | - | 240 | WP_004085761.1 | ribbon-helix-helix domain-containing protein | - |
| OK117_RS04395 (OK117_04410) | 1031048..1032082 | + | 1035 | WP_058565070.1 | hypothetical protein | - |
| OK117_RS04400 (OK117_04415) | 1032188..1032442 | + | 255 | Protein_849 | conjugal transfer protein TrbJ | - |
| OK117_RS04405 (OK117_04420) | 1032395..1032622 | - | 228 | WP_233341840.1 | type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family | - |
| OK117_RS04410 (OK117_04425) | 1032621..1032818 | + | 198 | WP_233341839.1 | hypothetical protein | - |
| OK117_RS04415 (OK117_04430) | 1032866..1033096 | + | 231 | WP_004091411.1 | DUF433 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 1013585..1032541 | 18956 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 160 a.a. Molecular weight: 17705.48 Da Isoelectric Point: 9.9283
>T262282 WP_199276042.1 NZ_CP109886:c1027926-1027447 [Xylella fastidiosa subsp. fastidiosa]
MQISTPHSLTATHRLDEFNCGEPSLDDWLKRRALTNHLNGASRTFVVVDANQYVLGYYALAAGSVAHQEATRAIRRNMPD
PVPVMVLGRLAVDTRAQGIKLGAALLKDTVTRVQSIAENVGVRALVVHALNERAKQFYEYYGFRASPMHLMTLMLPIKF
MQISTPHSLTATHRLDEFNCGEPSLDDWLKRRALTNHLNGASRTFVVVDANQYVLGYYALAAGSVAHQEATRAIRRNMPD
PVPVMVLGRLAVDTRAQGIKLGAALLKDTVTRVQSIAENVGVRALVVHALNERAKQFYEYYGFRASPMHLMTLMLPIKF
Download Length: 480 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|