Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 111394..112037 | Replicon | plasmid pEC488-1 |
Accession | NZ_CP109875 | ||
Organism | Escherichia coli strain EC488 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | V0UN72 |
Locus tag | NQ150_RS25735 | Protein ID | WP_001034044.1 |
Coordinates | 111621..112037 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | B1P7N7 |
Locus tag | NQ150_RS25730 | Protein ID | WP_001261286.1 |
Coordinates | 111394..111624 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NQ150_RS25720 (106732) | 106732..107157 | - | 426 | WP_000422741.1 | transposase | - |
NQ150_RS25725 (107228) | 107228..111013 | - | 3786 | WP_261630093.1 | pcar | - |
NQ150_RS25730 (111394) | 111394..111624 | + | 231 | WP_001261286.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
NQ150_RS25735 (111621) | 111621..112037 | + | 417 | WP_001034044.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NQ150_RS25740 (112112) | 112112..113677 | + | 1566 | WP_001128474.1 | AAA family ATPase | - |
NQ150_RS25745 (113662) | 113662..114684 | + | 1023 | WP_000361402.1 | helicase UvrD | - |
NQ150_RS25755 (115991) | 115991..116905 | + | 915 | WP_000949004.1 | iron/manganese ABC transporter substrate-binding protein SitA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | dfrA17 / aadA5 / qacE / sul1 / mph(A) / tet(B) / sitABCD | iucA / iucB / iucC / iucD / iutA | 1..133748 | 133748 | |
- | flank | IS/Tn | sitABCD | - | 114938..119440 | 4502 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15232.66 Da Isoelectric Point: 6.8536
>T262273 WP_001034044.1 NZ_CP109875:111621-112037 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CHW1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CKZ6 |