Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 103991..104634 | Replicon | plasmid pEC488-1 |
Accession | NZ_CP109875 | ||
Organism | Escherichia coli strain EC488 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | C7S9Y5 |
Locus tag | NQ150_RS25705 | Protein ID | WP_001034046.1 |
Coordinates | 104218..104634 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | V0SR71 |
Locus tag | NQ150_RS25700 | Protein ID | WP_001261278.1 |
Coordinates | 103991..104221 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NQ150_RS25670 (99502) | 99502..99807 | - | 306 | WP_001159868.1 | type II toxin-antitoxin system toxin CcdB | - |
NQ150_RS25675 (99809) | 99809..100027 | - | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | - |
NQ150_RS25680 (100618) | 100618..101106 | + | 489 | WP_011254646.1 | hypothetical protein | - |
NQ150_RS25685 (101140) | 101140..102273 | - | 1134 | WP_001542067.1 | DUF3800 domain-containing protein | - |
NQ150_RS25690 (102440) | 102440..103213 | - | 774 | WP_000905949.1 | hypothetical protein | - |
NQ150_RS25695 (103226) | 103226..103726 | - | 501 | WP_000528931.1 | HEPN family nuclease | - |
NQ150_RS25700 (103991) | 103991..104221 | + | 231 | WP_001261278.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
NQ150_RS25705 (104218) | 104218..104634 | + | 417 | WP_001034046.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NQ150_RS25710 (104741) | 104741..106354 | - | 1614 | WP_000080193.1 | IS66-like element ISEc23 family transposase | - |
NQ150_RS25715 (106385) | 106385..106735 | - | 351 | WP_000624722.1 | IS66 family insertion sequence element accessory protein TnpB | - |
NQ150_RS25720 (106732) | 106732..107157 | - | 426 | WP_000422741.1 | transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | dfrA17 / aadA5 / qacE / sul1 / mph(A) / tet(B) / sitABCD | iucA / iucB / iucC / iucD / iutA | 1..133748 | 133748 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 14978.31 Da Isoelectric Point: 6.7113
>T262272 WP_001034046.1 NZ_CP109875:104218-104634 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEAVLKNLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRA
AVDATTEVKVALRLAGTPIGPNDTAIAGHAIATGAILVTNNVREFERVPGLVLEDWAG
VNKIYMLDTNICSFIMREQPEAVLKNLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRA
AVDATTEVKVALRLAGTPIGPNDTAIAGHAIATGAILVTNNVREFERVPGLVLEDWAG
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9NXF9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V0SR71 |