Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 99502..100027 | Replicon | plasmid pEC488-1 |
| Accession | NZ_CP109875 | ||
| Organism | Escherichia coli strain EC488 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | V0SSI5 |
| Locus tag | NQ150_RS25670 | Protein ID | WP_001159868.1 |
| Coordinates | 99502..99807 (-) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | S1PPD8 |
| Locus tag | NQ150_RS25675 | Protein ID | WP_000813634.1 |
| Coordinates | 99809..100027 (-) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NQ150_RS25655 (95412) | 95412..96578 | - | 1167 | WP_000772446.1 | plasmid-partitioning protein SopA | - |
| NQ150_RS25660 (97166) | 97166..97921 | - | 756 | WP_024946706.1 | replication initiation protein RepE | - |
| NQ150_RS25665 (98695) | 98695..99501 | - | 807 | WP_000016982.1 | site-specific integrase | - |
| NQ150_RS25670 (99502) | 99502..99807 | - | 306 | WP_001159868.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
| NQ150_RS25675 (99809) | 99809..100027 | - | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
| NQ150_RS25680 (100618) | 100618..101106 | + | 489 | WP_011254646.1 | hypothetical protein | - |
| NQ150_RS25685 (101140) | 101140..102273 | - | 1134 | WP_001542067.1 | DUF3800 domain-containing protein | - |
| NQ150_RS25690 (102440) | 102440..103213 | - | 774 | WP_000905949.1 | hypothetical protein | - |
| NQ150_RS25695 (103226) | 103226..103726 | - | 501 | WP_000528931.1 | HEPN family nuclease | - |
| NQ150_RS25700 (103991) | 103991..104221 | + | 231 | WP_001261278.1 | type II toxin-antitoxin system VapB family antitoxin | - |
| NQ150_RS25705 (104218) | 104218..104634 | + | 417 | WP_001034046.1 | type II toxin-antitoxin system VapC family toxin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | dfrA17 / aadA5 / qacE / sul1 / mph(A) / tet(B) / sitABCD | iucA / iucB / iucC / iucD / iutA | 1..133748 | 133748 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11706.51 Da Isoelectric Point: 6.4674
>T262271 WP_001159868.1 NZ_CP109875:c99807-99502 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|