Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RHH(antitoxin)
Location 6549..7108 Replicon plasmid pEC488-1
Accession NZ_CP109875
Organism Escherichia coli strain EC488

Toxin (Protein)


Gene name relE Uniprot ID V0SVC8
Locus tag NQ150_RS25060 Protein ID WP_000421272.1
Coordinates 6549..6824 (-) Length 92 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID V0SRR3
Locus tag NQ150_RS25065 Protein ID WP_001387467.1
Coordinates 6824..7108 (-) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NQ150_RS25020 (2124) 2124..2306 - 183 WP_042344623.1 hypothetical protein -
NQ150_RS25025 (2373) 2373..2662 - 290 Protein_3 type II toxin-antitoxin system RelE/ParE family toxin -
NQ150_RS25030 (2649) 2649..2917 - 269 Protein_4 type II toxin-antitoxin system ParD family antitoxin -
NQ150_RS25035 (3449) 3449..3814 + 366 Protein_5 hypothetical protein -
NQ150_RS25040 (3906) 3906..5134 + 1229 WP_088895425.1 IS3-like element IS2 family transposase -
NQ150_RS25045 (5109) 5109..5954 + 846 WP_261630092.1 hypothetical protein -
NQ150_RS25050 (5987) 5987..6115 + 129 Protein_8 IS481 family transposase -
NQ150_RS25055 (6240) 6240..6443 - 204 Protein_9 hypothetical protein -
NQ150_RS25060 (6549) 6549..6824 - 276 WP_000421272.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NQ150_RS25065 (6824) 6824..7108 - 285 WP_001387467.1 ribbon-helix-helix domain-containing protein Antitoxin
NQ150_RS25070 (7713) 7713..8465 + 753 WP_000562172.1 IclR family transcriptional regulator -
NQ150_RS25075 (8511) 8511..9476 - 966 WP_001022265.1 2-keto-3-deoxygluconate transporter -
NQ150_RS25080 (9509) 9509..9889 - 381 WP_024946717.1 Rid family detoxifying hydrolase -
NQ150_RS25085 (9914) 9914..10804 - 891 WP_001077068.1 dihydrodipicolinate synthase family protein -
NQ150_RS25090 (11037) 11037..11231 - 195 WP_000796505.1 hypothetical protein -
NQ150_RS25095 (11205) 11205..11645 + 441 Protein_17 zinc-binding dehydrogenase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid dfrA17 / aadA5 / qacE / sul1 / mph(A) / tet(B) / sitABCD iucA / iucB / iucC / iucD / iutA 1..133748 133748


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-90)

Antitoxin

Ribbon-helix-helix protein, CopG

(14-51)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10749.45 Da        Isoelectric Point: 10.0871

>T262267 WP_000421272.1 NZ_CP109875:c6824-6549 [Escherichia coli]
MELKWTSKALSDLSRLFDFLVLASKPAAARTVQSLTQAPVILLTHPRMGEQLFQFEPREVRRIFAGEYEIRYEINGQTIY
VLRLWHTRENR

Download         Length: 276 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10460.87 Da        Isoelectric Point: 5.6558

>AT262267 WP_001387467.1 NZ_CP109875:c7108-6824 [Escherichia coli]
MQMKNNAAQATKVITAHVPLPMADKVDQMAARLERSRGWVIKQALSAWLAQEEERNRLTLEALDDVTSGQVIDHQAVQAW
SDSLSTDNPLPVPR

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V0SVC8

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0Y880

References